Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001632245.1 (Total 0 loci with Aca homologs)

1. Guilt-by-Association

No result on guilt by association

2. Homology Based

Show entries

Search:

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
GCF_001632245.1	NZ_CP015377.1	3574256	3574459	-	WP_031276782.1	68	0.275184708	707	-4.3717647	130	-4.3717647	---	MKPDASNHNPDPRYLRGLYEGAGLKQEEAARRIGITARALRNYVSETAGREAPYPVQFALECLANES	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas; Pseudomonas aeruginosa
GCF_001632245.1	NZ_CP015377.1	3574449	3574652	-	WP_023980106.1	68	0.90163526	8	-0.9359888	3	-0.9359888	AcrIE4-IF7\|57.8	MTTFTSIVTTNPDFGGFEFYVEAGQQFDDSAYEEAYGVSVPSAVVEEMNAKAAQLKDGEWLNVSHEA	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas; Pseudomonas aeruginosa

Showing 1 to 2 of 2 entries

3. CRISPRCasFinder Summary

No result on CrisprCasFinder