Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001687565.2 (Total 8 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Medium Confidence	Planococcus antarcticus DSM 14505	NZ_CP016534.2	WP_006828178.1	306168	306410	+	81	0	6.3367	Acr	0.430747973	787	-3.8208427	Not found in Prophage	Not found in Prophage	-	-	MTETTSFNIGDIVATTFILGFSIIIPAIIIFIIYKIIKRSEKRANERIALERENTVLVKKQLDDMNERVMIIEKMLREVE	No		Bacteria; Firmicutes; Bacilli; Bacillales; Planococcaceae; Planococcus; Planococcus antarcticus
Acr-Aca 1	Medium Confidence	Planococcus antarcticus DSM 14505	NZ_CP016534.2	WP_040851634.1	305828	306175	+	116	0.5	6.6459	WP_090793337.1\|HTH_5\|AcrIIA15\|34.6\|0.00011	0.115443349	971	-4.065252	Not found in Prophage	Not found in Prophage	-	-	MTHFNSGDHLLTVLEALSNSHRLRIIAVLSEGKQYVSQLARELGISRPLLYLHLQKLEEAELVTSDMEILESGKAAKYYMLNSFQIELNDQLVHKLANSLSVKKKNDNKGEKESD	No		Bacteria; Firmicutes; Bacilli; Bacillales; Planococcaceae; Planococcus; Planococcus antarcticus
Acr-Aca 2	Medium Confidence	Planococcus antarcticus DSM 14505	NZ_CP016534.2	WP_083387751.1	1319161	1319514	-	118	4.5	10.0561	Acr	0.147576971	1305	-4.4471397	Not found in Prophage	Not found in Prophage	-	-	MIFGSFFSLISGFLILAAIMVKSAPNSETYALLSLAVMSFSLSYLYPQFIQKDERTRMIREKAMFFSSFSFLFYAFVVTSALRFNLIHLSAIEAINILISLMISTIFISMVVLARKY	No		Bacteria; Firmicutes; Bacilli; Bacillales; Planococcaceae; Planococcus; Planococcus antarcticus
Acr-Aca 2	Medium Confidence	Planococcus antarcticus DSM 14505	NZ_CP016534.2	WP_065537085.1	1319567	1319770	-	68	-1.5	5.0644	WP_066083800.1\|HTH_3\|AcrIIA1\|58.3\|5.8e-17	0.149981664	467	-3.1388266	24	-3.1388266	PHAGE_Bacill_1_NC_009737-gi\|158348425\|ref\|YP_001522916.1\|\|1.33e-10	-	MNNKLKEFREKHDYSQDKLAKELGVSRQTIISIEKGRYNPSLPLALQIGKIFNTYIEDVFFLDETDE	No		Bacteria; Firmicutes; Bacilli; Bacillales; Planococcaceae; Planococcus; Planococcus antarcticus
Acr-Aca 3	Medium Confidence	Planococcus antarcticus DSM 14505	NZ_CP016534.2	WP_006831552.1	2023698	2024144	+	149	-9	4.4615	Acr	0.405350363	590	-3.4413652	Not found in Prophage	Not found in Prophage	-	-	MVEIEFLADEHGNQQVIDLITSIADRGMNDEDYAELAARIAQLFDYMKDIGVPPIEKRTLYGISSVGNPITLVDVVKELNHHPPLMEARANWRPVGAFRAIFFYEEDDKGNQSIYFTKAVIKQETYSRDFEHAISASEKMMVEFFKPE	No		Bacteria; Firmicutes; Bacilli; Bacillales; Planococcaceae; Planococcus; Planococcus antarcticus
Acr-Aca 3	Medium Confidence	Planococcus antarcticus DSM 14505	NZ_CP016534.2	WP_006831551.1	2024162	2024488	+	109	4.5	9.8159	WP_089723002.1\|HTH_3\|AcrIIA15\|32.5\|0.00049	0.508827451	592	-3.4480908	Not found in Prophage	Not found in Prophage	-	-	MANKNYNDVMGILRQVPKVNEHLNKISVIMGKKILKRRLELGLTQKEVVAMIKEHGDTFTQATLSKIESGADNIKSETYDKVFVALGGLEDLTPTFKENPKGKDLIHS	No		Bacteria; Firmicutes; Bacilli; Bacillales; Planococcaceae; Planococcus; Planococcus antarcticus
Acr-Aca 4	Medium Confidence	Planococcus antarcticus DSM 14505	NZ_CP016534.2	WP_006828307.1	2038142	2038501	+	120	6.5	10.1692	Acr	0.123122433	849	-3.907959	Not found in Prophage	Not found in Prophage	-	-	MKRTFVYVKNFDQQWKQNGLAAEQRELELQLLMDPGQGAVITGTGGLRKMRFSPESENQGKSGSYRIIYLDIQTSSHTILLLIYAKNQEATLKPNQKKILKQLVDQLKSSYTFERMDGK	No		Bacteria; Firmicutes; Bacilli; Bacillales; Planococcaceae; Planococcus; Planococcus antarcticus
Acr-Aca 4	Medium Confidence	Planococcus antarcticus DSM 14505	NZ_CP016534.2	WP_006828308.1	2038498	2038821	+	108	1	7.2039	AcrIIA15-1-WP_133418514.1\|HTH_19-1-AcrIIA15\|43.1\|2.5e-15	0.115546641	565	-3.3563669	Not found in Prophage	Not found in Prophage	PHAGE_Clostr_phiMMP02_NC_019421-gi\|414090411\|ref\|YP_006990524.1\|\|3.22e-06	-	MNENQFFDDLKSSLGQAIEYAEGNQSKARTKTVAIKELATFSAQDIKSLRLQMNLTQKSFAALIGVSVKTIESWEHGTNQPSGAARRLLEILSNRPHVAEEQQIVSV	No		Bacteria; Firmicutes; Bacilli; Bacillales; Planococcaceae; Planococcus; Planococcus antarcticus
Acr-Aca 5	Medium Confidence	Planococcus antarcticus DSM 14505	NZ_CP016534.2	WP_006830417.1	2847331	2847513	-	61	1.5	7.8254	Acr	0.618234944	1475	-4.618896	Not found in Prophage	Not found in Prophage	-	-	MEQFNLYKEVETEKLFGCLAPKQLKIASLGKKQVYAGSGIVMNCAVPWEVSVHLKSGAEQ	No		Bacteria; Firmicutes; Bacilli; Bacillales; Planococcaceae; Planococcus; Planococcus antarcticus
Acr-Aca 5	Medium Confidence	Planococcus antarcticus DSM 14505	NZ_CP016534.2	WP_065536642.1	2847830	2848276	-	149	2.5	8.2325	Acr	0.506424798	193	-2.16195	Not found in Prophage	Not found in Prophage	-	-	MKKYDFEELGNVSVFQDKLISEAMKEKQVKKSSVWTSFLKIYIRQREIILHAPVPDPFEDADEDELPPSIKLLNRNINPKYENQLYRWGIKAQKVGNFRIIYLIYDYHKILFLHAFDKQYNGDIKRQDIEKAEKIYEEYLEKYPSKYL	No		Bacteria; Firmicutes; Bacilli; Bacillales; Planococcaceae; Planococcus; Planococcus antarcticus

Showing 1 to 10 of 17 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

Show entries

Search:

GCF	NC_ID	CRISPR arrays	Nb CRISPRs	Evidence levels	Cas clusters	Nb Cas	Cas Types/ Subtyes
GCF_001687565.2	NZ_CP016534	NZ_CP016534_1[2026908;2028398] (evidence-level=4),	1	Nb_arrays_evidence-level_1=0,Nb_arrays_evidence-level_2=0,Nb_arrays_evidence-level_3=0,Nb_arrays_evidence-level_4=1	CAS-TypeIIU[2029282;2034490],	1	CAS-TypeIIU (n=1),

Showing 1 to 1 of 1 entries