Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001704615.3 (Total 4 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Medium Confidence	Acinetobacter defluvii	NZ_CP029397.2	WP_065993647.1	866883	867092	-	70	4.5	8.955	AcrIIA14-0-WP_046695989.1\|HTH_39\|40.6\|1.4e-09	0.371878296	479	-3.6178393	Not found in Prophage	Not found in Prophage	PHAGE_Mannhe_vB_MhS_587AP2_NC_028743-gi\|970580066\|ref\|YP_009193610.1\|\|5.47e-06	-	MNHQTQILAHLKQGKTLSQAEAINYYDCYRLSAVIQRLRRLGHDIVTHQEPNLNNKGTHARYELNEVQA	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter defluvii
Acr-Aca 1	Medium Confidence	Acinetobacter defluvii	NZ_CP029397.2	WP_065993646.1	867095	867316	-	74	3	9.0339	Acr	0.179441008	272	-2.929224	Not found in Prophage	Not found in Prophage	-	-	MTIKPIRVQFKTACQILDISRESLRHLVRTDKTFPKAIKTGEAKQAPVYFDYAQLIEWHNNQMQSLTNAELEA	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter defluvii
Acr-Aca 2	Medium Confidence	Acinetobacter defluvii	NZ_CP029397.2	WP_065992806.1	1986414	1986683	-	90	-3	5.0221	Acr	0.587465121	443	-3.5002837	Not found in Prophage	Not found in Prophage	-	-	MTKHDTNNALQTYDAGELVDAHTLAKSHLSWVNALVSTVIQNNKTGKTFFNQELLDVAQYLSDTFADEHDLQREAYQKEVDSNKKAVTL	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter defluvii
Acr-Aca 2	Medium Confidence	Acinetobacter defluvii	NZ_CP029397.2	WP_065992804.1	1986685	1986981	-	99	-4.5	4.8939	Acr	0.79027774	36	-1.0503123	Not found in Prophage	Not found in Prophage	-	-	MPKNTNTPKIYNDADLASMYGESCEFTEWLSTLIAQVKKETDQIKEKLSTHYNVDNCHFYTLDKLLALSEFMADERVATLERLHQEHAQEWAAHKEGV	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter defluvii
Acr-Aca 2	Medium Confidence	Acinetobacter defluvii	NZ_CP029397.2	WP_081406071.1	1986984	1987280	-	99	6.5	8.6628	Acr	0.32743123	1014	-4.3747334	Not found in Prophage	Not found in Prophage	-	-	MAIFLIASCSKPSYANGVQCQITEFALAGNKINTSAYSPLRAFFMRTISMRSHFMVKLERDTFECAGFLCYLSANPFQLCHPHHLAVIGKAPMNTGAH	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter defluvii
Acr-Aca 2	Medium Confidence	Acinetobacter defluvii	NZ_CP029397.2	WP_065992802.1	1987325	1987540	-	72	6	9.4805	AcrIIA14-0-WP_046695989.1\|HTH_39\|45.3\|4.2e-09	0.358230427	617	-3.859065	Not found in Prophage	Not found in Prophage	PHAGE_Mannhe_vB_MhS_587AP2_NC_028743-gi\|970580066\|ref\|YP_009193610.1\|\|9.06e-06	-	MSTNHQTQVLAHLKQGKTLSQAEAINLFHCYRLSAVINRLRNSGYDIVTHQEPNHNRDGYHARYEYRELKV	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter defluvii
Acr-Aca 3	Medium Confidence	Acinetobacter defluvii	NZ_CP029397.2	WP_065993056.1	2018573	2018848	-	92	5.5	8.6123	Acr	0.225927164	13	-0.46539235	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_JBD69_NC_030908-gi\|100020\|ref\|YP_009273645.1\|\|3.25e-06	-	MTNVSHTNELAKEKLPKYIETELGKEKLCIECQEYWPLDEEFWWTRKNKSLKDPNGIRYEAACKCCYNVRYRPGHVKGTYKVKSQHEKVAA	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter defluvii
Acr-Aca 3	Medium Confidence	Acinetobacter defluvii	NZ_CP029397.2	WP_065992740.1	2018860	2019174	-	105	1	7.0604	Acr	0.357459193	364	-3.2591465	Not found in Prophage	Not found in Prophage	-	-	MSEKLTDSITFKCTYEEKKEFEAIALAEKSDISKLSRVCMKKKIQEVREYLYSLQSLTCLTTDTRDTFELTAPLRDVTPPKTTATKKAHLCDQLSLICHTNELI	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter defluvii
Acr-Aca 3	Medium Confidence	Acinetobacter defluvii	NZ_CP029397.2	WP_065992739.1	2019186	2019386	-	67	4.5	9.6037	WP_060158618.1\|HTH_31\|AcrIIA14\|34.7\|7.4e-05	0.451570227	90	-1.8381522	Not found in Prophage	Not found in Prophage	-	-	MTYWSQLINELQDKEKGNMSQHEIAAQVPCSQNYISELKAGKKGKRISHEIAKGLEDLHKKKVQVS	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter defluvii
Acr-Aca 4	Medium Confidence	Acinetobacter defluvii	NZ_CP029390.2	WP_065995572.1	175	495	-	107	1	8.3104	Acr	0.185236004	1063	-4.4240813	Not found in Prophage	Not found in Prophage	-	-	MFEVEQKFNEEMRQIYDKSKELTPPYKPTRFKKMLDQYGGIETANRLLISSSKIPDGFTELYSRGPEALKLTVEYLILKPEYSALFNPDQQEIAKKRLKQLNIELP	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter defluvii

Showing 1 to 10 of 11 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

Show entries

Search:

GCF	NC_ID	CRISPR arrays	Nb CRISPRs	Evidence levels	Cas clusters	Nb Cas	Cas Types/ Subtyes
GCF_001704615.3	NZ_CP029397	NZ_CP029397_1[518405;518761] (evidence-level=2), NZ_CP029397_2[1200050;1201279] (evidence-level=4), NZ_CP029397_3[1713196;1713644] (evidence-level=4), NZ_CP029397_4[2245155;2247403] (evidence-level=4),	4	Nb_arrays_evidence-level_1=0,Nb_arrays_evidence-level_2=1,Nb_arrays_evidence-level_3=0,Nb_arrays_evidence-level_4=3	CAS-TypeIF[1496264;1504656],	1	CAS-TypeIF (n=1),

Showing 1 to 1 of 1 entries