Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001744795.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Mycobacterium phage Gengar	NC_031035.1	YP_009282287.1	34445	34831	+	129	8.5	11.3422	SRS2159246\|NODE_6248_length_459_cov_1.084158_1\|HTH_3\|AcrIIA1\|38.7\|0.003	0.215237244	60	-5.123948	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Gengar_NC_031035-gi\|100041\|ref\|YP_009282287.1\|\|5.20e-92	-	MSAFPVIWCTVLFVTATTALKQPESGTQNGPNAIPTFQLEWNSDAVADLCYRNGIRSRGQLAQRINVGRSTIYETFGKQWEGTATAQVLAQMAGVFGVPLGVLVREPGRSRRGSATIRQNRHVTKRAG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Timquatrovirus; Mycobacterium phage Gengar
Acr-Aca 1	Low Confidence	Mycobacterium phage Gengar	NC_031035.1	YP_009282288.1	34828	35022	+	65	-1	5.6119	Acr	0.370899648	63	-5.242314	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Gengar_NC_031035-gi\|100042\|ref\|YP_009282288.1\|\|3.35e-41	-	MIVLGQQHRQTLTYSQVIAERDAGRRIIAEQSDLIRRLTELNDRLAAAGGSDTLHAEPDMDRCG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Timquatrovirus; Mycobacterium phage Gengar
Acr-Aca 1	Low Confidence	Mycobacterium phage Gengar	NC_031035.1	YP_009282289.1	35101	35253	+	51	-1.5	4.3078	Acr	0.152725382	80	-5.4958224	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Gengar_NC_031035-gi\|100043\|ref\|YP_009282289.1\|\|3.93e-29	-	MSKPSINHDSPADTSNTDPMSTGSFIGWTLMLASTIITAIALGAMSVGLL	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Timquatrovirus; Mycobacterium phage Gengar

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder