Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001754725.1 (Total 2 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Salmonella phage BP12B	NC_031271.1	YP_009304428.1	6208	6333	+	42	8	11.1985	Acr	0.336429012	8	-2.1605444	Not found in Prophage	Not found in Prophage	PHAGE_Salmon_BP12B_NC_031271-gi\|100008\|ref\|YP_009304428.1\|\|1.08e-23	-	MRNFEKTRKANRFDMEEGQKKGKKLNKPVRDRASKRAAWEC	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Zindervirus; Salmonella virus BP12B
Acr-Aca 1	Low Confidence	Salmonella phage BP12B	NC_031271.1	YP_009304429.1	6337	6783	+	149	10	10.4555	AcrIIA1-1-WP_094517622.1\|HTH_38\|42.5\|1.2e-18	0.10882993	11	-2.7897575	Not found in Prophage	Not found in Prophage	PHAGE_Salmon_BP12B_NC_031271-gi\|100009\|ref\|YP_009304429.1\|\|2.11e-106	-	MELWRSIEGHEGYEVSSLGRVRSNKGILKEFIQDNGYAAVMLGAGVRKLVHRLVASAFIANPEGKPEVNHKDHVRHHNMAINLEWVTRQENIDHSNNITTFRLRNEITGEVVEGRNLAAFAKERGLLYPNLNKVNTGVRRSHKGWIKA	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Zindervirus; Salmonella virus BP12B
Acr-Aca 2	Low Confidence	Salmonella phage BP12B	NC_031271.1	YP_009304431.1	8734	9216	+	161	15.5	10.1725	Monaco_MBA1736_NODE_27_length_20403_cov_33.010861_28\|HTH_11-2-AcrIIA7\|35.0\|4e-12	0.110230203	12	-2.948333	Not found in Prophage	Not found in Prophage	PHAGE_Salmon_BP12B_NC_031271-gi\|100011\|ref\|YP_009304431.1\|\|6.33e-119	-	MLTKLRSFEAAGYAVKEDGTIISPKGIVRKPTPLGKKVKYLYISWRDKVSKRTVTETIHRLVACKYIPNPHGLPEVHHKDFDPFNCSKYNLEWTDGKTNCEYSYARVEAALARHATLISPEGIRFDVFNVRKFCREHNLNPPSIFEVLSGKRKSHKGWTI	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Zindervirus; Salmonella virus BP12B
Acr-Aca 2	Low Confidence	Salmonella phage BP12B	NC_031271.1	YP_009304432.1	9300	9470	+	57	4	10.3953	Acr	0.407274393	21	-4.0386386	Not found in Prophage	Not found in Prophage	PHAGE_Salmon_BP12B_NC_031271-gi\|100012\|ref\|YP_009304432.1\|\|2.18e-34	-	MSRNESKHSLKFLEQHEDLAAKVTNQAFLFAQLTLAEAKKNSLTREQIIKEGTKRS	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Zindervirus; Salmonella virus BP12B

Showing 1 to 4 of 4 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder