Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001755545.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Pseudomonas phage O4	NC_031274.1	YP_009304522.1	33457	33618	-	54	-4	4.4778	Acr	0.600736066	6	-0.84718645	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_O4_NC_031274-gi\|100043\|ref\|YP_009304522.1\|\|7.67e-32	-	MDRVYLVIEEDEYGITETIYVYRSLDRAEKIVHKLNLSYSNYRYYVEEHLFND	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; UNKNOWN_genus; Pseudomonas phage O4
Acr-Aca 1	Low Confidence	Pseudomonas phage O4	NC_031274.1	YP_009304523.1	33662	33868	-	69	4	8.7244	Acr	0.517621076	7	-0.85683084	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_O4_NC_031274-gi\|100044\|ref\|YP_009304523.1\|\|2.22e-46	-	MKMIKEKDGKPWCKFCPEKTVRAVWRATGMGMSKHACEAHREDLRKYELERRDDGYMTEADYQTWGRL	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; UNKNOWN_genus; Pseudomonas phage O4
Acr-Aca 1	Low Confidence	Pseudomonas phage O4	NC_031274.1	YP_009304524.1	33865	34365	-	167	-6.5	4.6799	AcrIIA1-0-WP_110513172.1\|HTH_26\|44.0\|0.0082	0.139016035	10	-1.5709648	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_O4_NC_031274-gi\|100045\|ref\|YP_009304524.1\|\|1.02e-119	-	MTDVKARNLILGRFFENNYNELIKRVSFRAGSPENAEDIVQEAFVRALKYWNSYDPERKELGAWFNSILNNALRDFKRDERRYGMCEEFDEEEVDGVALSQTESGLRKFIDRAISERSSNIADVLHLYFILGYKPREIVEVTDADAAFVSRMVYNFREELKEKIGE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; UNKNOWN_genus; Pseudomonas phage O4

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder