Results - Acr-Aca DB

Anti-CRISPR Results - GCF_002149405.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Salmonella virus Stitch	NC_027297.1	YP_009145984.1	23083	23436	-	118	2	7.6039	Acr	0.392134172	16	-1.6993346	Not found in Prophage	Not found in Prophage	PHAGE_Salmon_Stitch_NC_027297-gi\|100043\|ref\|YP_009145984.1\|\|5.92e-86	-	MFNWKLGVLLAAAITITGCAEEIKPEPSHELKQAHVDWPKGLQPCSFDFKFEKKLATNGEDGVVVVVPYKDWNAKAKCEEAVYSYISRLTGMVCFYRQDLQEKRCLVYYPPITNRKD	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Demerecviridae; Epseptimavirus; Salmonella virus Stitch
Acr-Aca 1	Low Confidence	Salmonella virus Stitch	NC_027297.1	YP_009145985.1	23367	23816	-	150	6.5	9.8374	WP_038881529.1\|HTH_28-3-AcrIIA7\|31.9\|0.0027	0.426158131	124	-4.6073346	Not found in Prophage	Not found in Prophage	PHAGE_Salmon_Stitch_NC_027297-gi\|100044\|ref\|YP_009145985.1\|\|1.45e-107	-	MDLIQKLLSGIWQGKWYILGAGLAIGIGFGAYHLVNKVETLAGDLAVATKKISTLETSLNKVKTESELRETRMNQYFTMNNISQADLDKKIKQLDKALNRQDVIAAKPGLVTLIAKKQNKEFEERLACLTGNLEYCSQPQSQSQAVQKK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Demerecviridae; Epseptimavirus; Salmonella virus Stitch

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder