Results - Acr-Aca DB

Anti-CRISPR Results - GCF_002602565.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Pectobacterium phage PhiM1	NC_041854.1	YP_009591946.1	15169	15426	+	86	4	10.0405	Acr	0.342093907	10	-3.615911	Not found in Prophage	Not found in Prophage	PHAGE_Pectob_PhiM1_NC_041854-gi\|100023\|ref\|YP_009591946.1\|\|1.25e-56	-	MTKMNNKARRTARELKHLGASIQTTSLLGKVDATRDAEDATRLREMLDDVEAPIGLLEHELLKLRKRKPALYRELRDEFQMGYLG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Phimunavirus; Pectobacterium virus fM1
Acr-Aca 1	Low Confidence	Pectobacterium phage PhiM1	NC_041854.1	YP_009591947.1	15423	15668	+	82	-7	4.0684	ERS698714\|NODE_1166_length_747_cov_2.005780_2\|HTH_3\|AcrIIA1\|40.7\|0.0032	0.594577553	12	-3.7274475	Not found in Prophage	Not found in Prophage	PHAGE_Pectob_vB_PatP_CB5_NC_042131-gi\|100032\|ref\|YP_009625544.1\|\|8.85e-54	-	MSTRRRISRILKEKGLSATLVYDGSGVSADDYGWWTITFDQETAKFLTSQDWSGVIEISDLDAGFEELAELPTRLGDIPDA	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Phimunavirus; Pectobacterium virus fM1
Acr-Aca 1	Low Confidence	Pectobacterium phage PhiM1	NC_041854.1	YP_009591948.1	15661	16086	+	142	15.5	10.6846	Acr	0.077986999	17	-3.900776	Not found in Prophage	Not found in Prophage	PHAGE_Pectob_PhiM1_NC_041854-gi\|100025\|ref\|YP_009591948.1\|\|9.85e-104	-	MRKLTRSQVRPYTMRLLQQQGGVCCLCGKPVDLSEKGALVLDHDHTTGQVRGALHRSCNASEGKVANAAGRWGAKSMAYSDIIPWLENLLVYLKKPAQDVLYPTFQTEDEKRMARNAKERTRRATKKARVLVRKSNVSVKD	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Phimunavirus; Pectobacterium virus fM1
Acr-Aca 1	Low Confidence	Pectobacterium phage PhiM1	NC_041854.1	YP_009591949.1	16067	16288	+	74	-7	4.0201	Acr	0.568233747	3	-2.5278485	Not found in Prophage	Not found in Prophage	PHAGE_Pectob_PhiM1_NC_041854-gi\|100026\|ref\|YP_009591949.1\|\|4.12e-48	-	MLVSKTDFLVSCGVTYETLLDRDPEDKFLTYTLEQVVGIDGAVRNDAETVYLNRDQAIEIAKTILRNEGYDIV	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Phimunavirus; Pectobacterium virus fM1

Showing 1 to 4 of 4 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder