Results - Acr-Aca DB

Anti-CRISPR Results - GCF_002619885.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Notice: Undefined offset: 1 in /array1/www/AcrDB/helper_php/dynamic_external_links.php on line 43

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Escherichia phage CF2	NC_041919.1	Protein(98578-98919)	98578	98919	+	114	5.5	8.8579	Acr	Not found in Prophage	Not found in Prophage	PHAGE_Shigel_Sf24_NC_042078-gi\|100243\|ref\|YP_009619322.1\|\|6.34e-80	-	MTKILVLCIGLISFSALADTSYTEIREYVNRTAADYCGKNKACQAEFAQKLIYAYKDGERDKSSRYKNDTLLKRYAKKWNTLECSVAEEKDKAACHSMVDRLVDSYNRGLSTR*	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tequatrovirus; Escherichia virus CF2
Acr-Aca 1	Low Confidence	Escherichia phage CF2	NC_041919.1	Protein(102356-102529)	102356	102529	+	58	-1.5	5.0203	Acr	Not found in Prophage	Not found in Prophage	PHAGE_Shigel_Sf24_NC_042078-gi\|100229\|ref\|YP_009619308.1\|\|2.81e-36	-	MKTEKQMFLMKLIEEYANAVSDYEYSARERGTAFAKEEMKIMVDAHTKLQNFIENVI*	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tequatrovirus; Escherichia virus CF2
Acr-Aca 1	Low Confidence	Escherichia phage CF2	NC_041919.1	Protein(102172-102366)	102172	102366	+	65	-2.5	4.7815	AcrIIA15-0-SRS741442\|NODE_87_length_19421_cov_10.774452_16\|HTH_26\|AcrIIA15\|39.5\|0.0089	Not found in Prophage	Not found in Prophage	PHAGE_Escher_slur04_NC_042130-gi\|100075\|ref\|YP_009625321.1\|\|5.83e-42	-	MLTREQFEKIIKLARDIEIDSYQLAVEHCEGYSYDGIEAAKKDLDKSKAKLVQYLEMIRWNNEN*	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tequatrovirus; Escherichia virus CF2
Acr-Aca 1	Low Confidence	Escherichia phage CF2	NC_041919.1	Protein(101966-102169)	101966	102169	+	68	-5.5	4.3313	Acr	Not found in Prophage	Not found in Prophage	PHAGE_Entero_vB_EcoM_ACG_C40_NC_019399-gi\|414086468\|ref\|YP_006986657.1\|\|2.34e-42	-	MTRIEQADKIKELVALIRKADEELSDFAWFSAGIANKGIEKFEAKVDNALEALDMFLDEIIDHNTRV*	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tequatrovirus; Escherichia virus CF2
Acr-Aca 1	Low Confidence	Escherichia phage CF2	NC_041919.1	Protein(101778-101966)	101778	101966	+	63	-8.5	3.8658	Acr	Not found in Prophage	Not found in Prophage	PHAGE_Shigel_SHFML_11_NC_030953-gi\|100010\|ref\|YP_009277480.1\|\|3.13e-40	-	MKIEALNQEGNIYVIINGDFFVDMDEVTSEELVELLKKRYDMCDEAATHMACAIFSLSYVVE*	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tequatrovirus; Escherichia virus CF2
Acr-Aca 1	Low Confidence	Escherichia phage CF2	NC_041919.1	Protein(101296-101682)	101296	101682	+	129	-1.5	5.6374	Acr	Not found in Prophage	Not found in Prophage	PHAGE_Escher_slur03_NC_042129-gi\|100179\|ref\|YP_009625143.1\|\|1.11e-90	-	MKFSDFSQSGKPSKADEYLGLLMAAQAYFHSAHFETKSYARHKAYDFIFSELPDLIDKFGEQYLGYSGRKYTPSIPDASKLPTDTIKMIDRILDQSNSIYKEMPPAIQSTIDDITGMFYQSKYLLSLE*	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tequatrovirus; Escherichia virus CF2
Acr-Aca 1	Low Confidence	Escherichia phage CF2	NC_041919.1	Protein(101006-101299)	101006	101299	+	98	-4	4.6234	Acr	Not found in Prophage	Not found in Prophage	PHAGE_Escher_slur03_NC_042129-gi\|100178\|ref\|YP_009625142.1\|\|3.50e-69	-	MALKATALFAMLGLAFALSPPIEANVDPHFDKFMESGIRHVYMLFENKSVESSEQFYSFMRTTYKNDPCSSDFECIERGAEMAQSYARIMNIKLETE*	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tequatrovirus; Escherichia virus CF2
Acr-Aca 1	Low Confidence	Escherichia phage CF2	NC_041919.1	Protein(100781-100993)	100781	100993	+	71	7	10.8398	Acr	Not found in Prophage	Not found in Prophage	PHAGE_Shigel_Sf24_NC_042078-gi\|100235\|ref\|YP_009619314.1\|\|5.68e-46	-	MLQLTEKQLRNLTVLQLDEIRREVGNIISALRREVSLNQSPADYTRLRNFEKYLDKVKAVHRHKVNTGQK*	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tequatrovirus; Escherichia virus CF2
Acr-Aca 1	Low Confidence	Escherichia phage CF2	NC_041919.1	Protein(100157-100738)	100157	100738	+	194	0.5	6.6273	Acr	Not found in Prophage	Not found in Prophage	PHAGE_Shigel_Sf21_NC_042077-gi\|100104\|ref\|YP_009618918.1\|\|5.83e-145	-	MASLIFTYAAMNAGKSASLLTAAHNYKERGMGVLVLKPAIDTRDSVCEVVSRIGIKQEANIITDDMDIFEFYKWAEAQKDIHCVFVDEAQFLKTEQVHQLSRIVDTYNVPVMAYGLRTDFAGKLFEGSKELLAIADKLIELKAVCHCGKKAIMTARLMEDGTPVKEGNQICIGDEIYVSLCRKHWNELTKKLG*	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tequatrovirus; Escherichia virus CF2
Acr-Aca 1	Low Confidence	Escherichia phage CF2	NC_041919.1	Protein(99962-100147)	99962	100147	+	62	-9	4.0649	Acr	Not found in Prophage	Not found in Prophage	PHAGE_Shigel_Sf21_NC_042077-gi\|100105\|ref\|YP_009618919.1\|\|1.51e-38	-	MSLSKEQKDKLFELIHELLDEHTEANTFYDEYGPLSPEQQEEFADRFDKKENELIAYVNML*	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Tequatrovirus; Escherichia virus CF2

Showing 1 to 10 of 28 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder