Results - Acr-Aca DB

Anti-CRISPR Results - GCF_002623125.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Propionibacterium phage PHL117M01	NC_041956.1	YP_009603760.1	28900	29070	+	57	9.5	11.2748	Acr	0.170173405	6	-3.0153947	Not found in Prophage	Not found in Prophage	PHAGE_Propio_PHL117M01_NC_041956-gi\|100045\|ref\|YP_009603760.1\|\|5.90e-35	-	MEKTNTPPQTEHPLKRTKQPLESISRARARYSYPQRFPGRYRGKQDPYKARRGSET	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Pahexavirus; Propionibacterium virus PHL117M01
Acr-Aca 1	Low Confidence	Propionibacterium phage PHL117M01	NC_041956.1	YP_009603761.1	29070	29372	+	101	8.5	10.7955	3300017963_____Ga0180437_10001802_15\|HTH_24\|AcrVA3\|39.1\|1.3e-07	0.144327004	19	-4.0019007	Not found in Prophage	Not found in Prophage	PHAGE_Propio_PHL117M01_NC_041956-gi\|100046\|ref\|YP_009603761.1\|\|3.42e-70	-	MAHTNRTASSAHRRWRQRLITQARQQGQTECPLCGVTITWDTYQLPTSPEADHITPVSRGGLNTLDNGQIICRTCNRSKGNRTQPNIQFQQQTTKTLIPW	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Pahexavirus; Propionibacterium virus PHL117M01

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder