Results - Acr-Aca DB

Anti-CRISPR Results - GCF_002623325.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Tsukamurella phage TIN4	NC_041962.1	YP_009604180.1	43718	43903	-	62	3	10.2766	AcrIIA7-2-3300006875_____Ga0075473_10000442_12\|HTH_DeoR\|39.3\|0.0046	0.216592769	56	-4.192089	Not found in Prophage	Not found in Prophage	PHAGE_Tsukam_TIN4_NC_041962-gi\|100052\|ref\|YP_009604180.1\|\|5.46e-40	-	MNVAPEQKMLNTKQVSDILLVEPGTVRELVRAGKFPNATRPGKGWLIPQSDVTNYIKETNK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Tinduovirus; Tsukamurella virus TIN4
Acr-Aca 1	Low Confidence	Tsukamurella phage TIN4	NC_041962.1	YP_009604181.1	43887	44162	-	92	3.5	8.0349	Acr	0.59924707	10	-2.001809	Not found in Prophage	Not found in Prophage	PHAGE_Tsukam_TIN4_NC_041962-gi\|100053\|ref\|YP_009604181.1\|\|6.44e-65	-	MKAEGCRFRNKRCQFPSDKHANLIPVSIEDTTFRFQIEWDNQYRNAPLETRERYVCRLCADIVNQELAHLELESKLIDKHYGKESRRERCT	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Tinduovirus; Tsukamurella virus TIN4

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder