Results - Acr-Aca DB

Anti-CRISPR Results - GCF_002826545.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Stenotrophomonas phage PSH1	NC_010429.1	YP_001718373.1	5544	5924	-	127	4	9.6182	Acr	0.152773337	3	-4.7727847	Not found in Prophage	Not found in Prophage	PHAGE_Stenot_PSH1_NC_010429-gi\|100006\|ref\|YP_001718373.1\|\|1.52e-89	-	MIEFDPHHRIDLTGPWAGFSFLGDRLITPEGRELLPEDLAWLSLTACQAQEWRRMMEAARSVPSIDSSRNVSNRNAGIRHHPATVVNLRDVVSRRKQRSAVAIAGPDAEPPAAGLPIQGPMPRQRM	No	No	Viruses; Hofneiviricota; Faserviricetes; Tubulavirales; Inoviridae; Psecadovirus; Stenotrophomonas virus PSH1
Acr-Aca 1	Low Confidence	Stenotrophomonas phage PSH1	NC_010429.1	YP_001718374.1	5921	6394	-	158	6.5	9.5301	3300006922_____Ga0098045_1000637_11\|HTH_3\|AcrIIA14\|45.8\|0.00018	0.197738512	7	-5.625588	Not found in Prophage	Not found in Prophage	PHAGE_Stenot_PSH1_NC_010429-gi\|100007\|ref\|YP_001718374.1\|\|4.87e-115	-	MDWNDFFERTRVAAKVESYSKLAPLLGITDGAIGHYRMGRRVPQVWVVADALRIQGHPEPEKQAIEIMKRAALTSPERTFWKRLAATAMALCLAVGFALPHKAQAAVAGFDKPTVYTLCEMLYRVVTAFVSSAWQWLGLWLGSCLRPQSPAKDEIAA	No	No	Viruses; Hofneiviricota; Faserviricetes; Tubulavirales; Inoviridae; Psecadovirus; Stenotrophomonas virus PSH1

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder