Results - Acr-Aca DB

Anti-CRISPR Results - GCF_002958465.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Pseudomonas phage Bjorn	NC_042103.1	YP_009622529.1	43070	43522	+	151	-0.5	6.2504	2061766007_____rumenHiSeq_NODE_3980549_len_39699_cov_3_310915_35\|HTH_Tnp_ISL3-1-AcrIF13\|42.4\|0.0099	0.292169341	30	-4.320513	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_Bjorn_NC_042103-gi\|100066\|ref\|YP_009622529.1\|\|1.43e-108	-	MSVVLITDAPKATKQEKLDLYCQGIANGLSKERAYIEAGYAEGMARANAQKYHRQNAQYIQGFLSEHIGSHAPTALKVLLEIMNDPNEKGGIRLKATQDILDRAGFGAKQKLEITTKEVKDLSTEELQDEIRKLTEDNPDLLKIFGAKAE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Bjornvirus; Pseudomonas virus Bjorn
Acr-Aca 1	Low Confidence	Pseudomonas phage Bjorn	NC_042103.1	YP_009622530.1	43545	43970	+	142	2.5	8.3884	Acr	0.111370793	65	-5.6225653	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_Bjorn_NC_042103-gi\|100067\|ref\|YP_009622530.1\|\|2.38e-101	-	MKVREGLVLKWYRDSLGKWTGGYGHLRKPGEESLTITPALAEKWLSEDIRIARDAAKKQFALLPIQTENLLDTLVSVNFQLGTAWTAIHKRTWALMVAGKYPEAAQEAKNSIWYTQTPVRVEDLASALYEAHRLGAEYDAL	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Bjornvirus; Pseudomonas virus Bjorn
Acr-Aca 1	Low Confidence	Pseudomonas phage Bjorn	NC_042103.1	YP_009622531.1	43960	44448	+	163	0	6.4715	Acr	0.108705563	22	-3.9154391	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_Bjorn_NC_042103-gi\|100068\|ref\|YP_009622531.1\|\|2.28e-119	-	MPSEFLQFSGPLNTEYAYDESDALGSDYWRVTKTFRYYIGGLDSQRWVTVPAGYLTDGASVPRIFWNIIPPWGRYGAATTVHDILCEYLEIYDHGEIVKITRAEADAILYEAMGVLKVKESDRDRIYRAVCLYRTLTGVNKPMGSKRKRILEATWAIRNLGE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Bjornvirus; Pseudomonas virus Bjorn

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder