Results - Acr-Aca DB

Anti-CRISPR Results - GCF_002968655.1 (Total 0 loci with Aca homologs)

1. Guilt-by-Association

No result on guilt by association

2. Homology Based

Show entries

Search:

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
GCF_002968655.1	NZ_CP027172.1	5621341	5621643	+	WP_034001826.1	101	0.921252496	1	1.7858299	Not found in Prophage	Not found in Prophage	AcrIF6\|99.0	MKVPAFFAANILTIEQIIEAINNDGSAMTSAPEIAGYYAWDAATDALESENDLEQLTEDDFVAHLEVLEERGAKIDRDAAVAVALQFQAAAVNDLHSGDE	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas; Pseudomonas aeruginosa
GCF_002968655.1	NZ_CP027172.1	5621640	5621852	+	WP_004351242.1	71	0.30724594	1153	-4.7577453	Not found in Prophage	Not found in Prophage	---	MKPDSANHNPDPRYLRGLVDKAGVSQRQAAELLGLSWPGFRNYLRDESHQLYRAAPYTVQFALECLANES	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas; Pseudomonas aeruginosa

Showing 1 to 2 of 2 entries

3. CRISPRCasFinder Summary

No result on CrisprCasFinder