Results - Acr-Aca DB

Anti-CRISPR Results - GCF_002997555.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Microbacterium phage Golden	NC_042117.1	YP_009624189.1	34806	35030	-	75	5	10.8102	Acr	0.400452154	10	-3.8307023	Not found in Prophage	Not found in Prophage	PHAGE_Microb_Golden_NC_042117-gi\|100049\|ref\|YP_009624189.1\|\|3.27e-49	-	MNSSMKAKIAAITAAAEAKGIVQGGRVRLTGTERTGTVKRVEYNDIRVIWDEGSRQHPSISATWTGLHRLEPVT	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Kojivirus; Microbacterium virus Golden
Acr-Aca 1	Low Confidence	Microbacterium phage Golden	NC_042117.1	YP_009624190.1	35050	35253	-	68	2	8.7054	REF:641201347_____641201239_57\|HTH_3\|AcrIIA15\|34.1\|0.00077	0.307340511	43	-5.305773	Not found in Prophage	Not found in Prophage	PHAGE_Microb_Golden_NC_042117-gi\|100050\|ref\|YP_009624190.1\|\|1.57e-41	-	MDIKQLLTSAITDQDSRVIHRLLNDAVELKAVTAQVATKLGHLADVMYTGTFAVRQAAAASALALVK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Kojivirus; Microbacterium virus Golden
Acr-Aca 1	Low Confidence	Microbacterium phage Golden	NC_042117.1	YP_009624191.1	35287	35658	-	124	12	10.8019	Acr	0.247150657	5	-3.4027915	Not found in Prophage	Not found in Prophage	PHAGE_Microb_Golden_NC_042117-gi\|100051\|ref\|YP_009624191.1\|\|1.79e-84	-	MEDSELLKMLDGLVKLTPEEEAASPQPMSKTARKKLWRDQPPDPNSNTSKKKERARLAARTPEQVRRDEILEERKRLQELAKKANADRLVDRIDNSPVYNDARRHYAEHKKVQQKRKKRSRPV	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Kojivirus; Microbacterium virus Golden
Acr-Aca 1	Low Confidence	Microbacterium phage Golden	NC_042117.1	YP_009624192.1	35701	35886	-	62	-5	3.9512	Acr	0.319271686	6	-3.5031886	Not found in Prophage	Not found in Prophage	PHAGE_Microb_Golden_NC_042117-gi\|100052\|ref\|YP_009624192.1\|\|2.45e-40	-	MSWEAYLDSLLWGSWPFTATPEPVPNTFRSNPQPREGFVDARRDDGCIPSITVLEDISIAC	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Kojivirus; Microbacterium virus Golden

Showing 1 to 4 of 4 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder