Results - Acr-Aca DB

Anti-CRISPR Results - GCF_003060845.1 (Total 0 loci with Aca homologs)

1. Guilt-by-Association

No result on guilt by association

2. Homology Based

Show entries

Search:

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
GCF_003060845.1	NZ_CP028917.1	5754564	5754866	+	WP_034001826.1	101	0.921252496	1	1.7858299	1	1.7858299	AcrIF6\|99.0	MKVPAFFAANILTIEQIIEAINNDGSAMTSAPEIAGYYAWDAATDALESENDLEQLTEDDFVAHLEVLEERGAKIDRDAAVAVALQFQAAAVNDLHSGDE	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas; Pseudomonas aeruginosa
GCF_003060845.1	NZ_CP028917.1	5754863	5755075	+	WP_108565260.1	71	0.309256129	751	-4.525112	81	-4.525112	---	MKPDSANHNPDPRYLRGLVDKAGISQRQAAELLGLSWPGFRNYLRDESHQLYRAAPYTVQFALECMANES	Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas; Pseudomonas aeruginosa

Showing 1 to 2 of 2 entries

3. CRISPRCasFinder Summary

No result on CrisprCasFinder