Results - Acr-Aca DB

Anti-CRISPR Results - GCF_003183085.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Gordonia phage Sour	NC_042132.1	YP_009625614.1	37306	37566	-	87	3	10.0778	Acr	0.161460395	20	-4.2415466	Not found in Prophage	Not found in Prophage	PHAGE_Gordon_Sour_NC_042132-gi\|100044\|ref\|YP_009625614.1\|\|7.19e-59	-	MARKIDPDPDGQEQRVQVFLSRSEVAERIGLKSIRSLSGLNLPPHDALVGNHKGYLVETIDQWNANRPGRGRWGARDPEPRSAPQA	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Sourvirus; Gordonia virus Sour
Acr-Aca 1	Low Confidence	Gordonia phage Sour	NC_042132.1	YP_009625615.1	37568	37942	-	125	-2.5	5.528	WP_146843788.1\|HTH_31\|AcrIIA15\|38.2\|0.0058	0.370287098	72	-5.6568375	Not found in Prophage	Not found in Prophage	PHAGE_Gordon_Sour_NC_042132-gi\|100045\|ref\|YP_009625615.1\|\|3.85e-89	-	MSTPTGYEHGLGLTILAHRRYLGLSQFEMADALKMNPHSYKRIETDRRPCPPGLLDNVVGLVAEFDRALDAVLDEWASIHPGDRITMSATDTPLHRAALMRAAVEFGGTTPIIIGDDNTEVRAG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Sourvirus; Gordonia virus Sour

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder