Results - Acr-Aca DB

Anti-CRISPR Results - GCF_003193665.1 (Total 6 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Staphylococcus aureus	NZ_CP029649.1	WP_000213811.1	220180	220392	+	71	6.5	10.6555	WP_082410099.1\|HTH_3\|AcrIIA1\|44.8\|8.8e-07	0.302961321	1319	-4.314323	185	-4.314323	PHAGE_Staphy_tp310_2_NC_009762-gi\|156603955\|ref\|YP_001429901.1\|\|1.39e-45	-	MTTSVADKPYLKIKSLIALKGTNQKEVAKAIGMSRSLLSIKINRINGRDFTTSEAKKLADHLNVKVDDFF	No	No	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
Acr-Aca 1	Low Confidence	Staphylococcus aureus	NZ_CP029649.1	WP_000435357.1	220440	220883	+	148	3.5	8.3432	Acr	0.521032226	29	-0.16580665	6	-0.16580665	PHAGE_Staphy_tp310_2_NC_009762-gi\|156603956\|ref\|YP_001429902.1\|\|2.20e-104	-	MEQITLTKEELKEIIAKEVRNAIKGEKPISSGAIFSKVRINNDDLEEINKKLNFAKDLSLGRLRKLNHPIPLKKYQHGFESIHQKAYVQDVHDHIRKLTLSIFGVTLNSDLSESEYNLAAKIYRDIKNYYLYIYEKRVSELTIDDFE	No	No	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
Acr-Aca 2	Low Confidence	Staphylococcus aureus	NZ_CP029649.1	WP_001217295.1	474873	475067	-	65	-10	3.8427	Acr	0.738644857	1	1.4064894	Not found in Prophage	Not found in Prophage	-	-	MRIEDAYRKDVIITLLNNEEYEGFVTDYENEFESETGNLVVDIQTDFAVYSFDETEIKSIRLLK	No	No	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
Acr-Aca 2	Low Confidence	Staphylococcus aureus	NZ_CP029649.1	WP_078367461.1	475078	475539	-	154	9.5	9.6679	AcrIIA15-1-WP_078064622.1\|HTH_7\|81.8\|1.3e-07	0.141603182	405	-2.705081	Not found in Prophage	Not found in Prophage	PHAGE_Thermu_OH2_NC_021784-gi\|526118333\|ref\|YP_008240330.1\|\|2.46e-08	-	MPHVGSWRDKFFKEREGKYQVEVKEAKLQEKAKNQMKEMIESCKMKIEINCEKQNGHMLGHHLYNENKKRAILNNKKLLSYTILSIDLLNELLREKMSTGNLILSDELFDMKEIINFNQIIGKVHIDNVYIETRKGKVHYSKTGAHIVPYIDK	No	No	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
Acr-Aca 3	Low Confidence	Staphylococcus aureus	NZ_CP029649.1	WP_000956747.1	477729	477980	-	84	-8	4.1532	Acr	0.674890981	28	-0.1293838	Not found in Prophage	Not found in Prophage	-	-	MLTLIKLKEDEQVIIYEYIPEDDISNGKGSVTFNKKDAEVIDFSLSEIENEEYFMLYRNKSFSVVRDFIEKQEFPENYKIAWY	No	No	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
Acr-Aca 3	Low Confidence	Staphylococcus aureus	NZ_CP029649.1	WP_001791646.1	477981	478154	-	58	9.5	10.3816	AcrIIA15-1-WP_078064622.1\|HTH_7\|66.7\|3e-12	0.344605937	269	-2.2149172	Not found in Prophage	Not found in Prophage	-	-	MATFKRRKNNKKQDLILLRHEALEHYLMNKYNFNYDYAHKIVSKKYDYSIFIKKKVD	No	No	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
Acr-Aca 3	Low Confidence	Staphylococcus aureus	NZ_CP029649.1	WP_000477492.1	478109	478213	-	35	4	10.1892	Acr	0.538471538	106	-1.1956731	Not found in Prophage	Not found in Prophage	-	-	MFKVNYSILSYYPEYNIAVSWQRLREGKTIKNKI	No	No	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
Acr-Aca 4	Low Confidence	Staphylococcus aureus	NZ_CP029649.1	WP_001802045.1	650046	650270	-	75	3.5	9.7175	REF:638275532_____638277452_29\|HTH_3\|AcrIIA14\|71.4\|1.1e-22	0.525789922	535	-3.0827765	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_96_NC_007057-gi\|66395937\|ref\|YP_240261.1\|\|1.28e-27	-	MLIQERGLKMTELNNIINSLQSLFESESGYKISKNSGVPYQTVQDLRNGKTKLEDARFRTIIKLYSYYVSLKEH	No	No	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
Acr-Aca 4	Low Confidence	Staphylococcus aureus	NZ_CP029649.1	WP_000765708.1	650227	650373	-	49	2.5	9.8369	Acr	0.274493496	1295	-4.2945156	Not found in Prophage	Not found in Prophage	-	-	MKLFYIVFLIIIWLNIFLGNEIIHTLTVLITTLYIVNSRKGIKNDRVE	No	No	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
Acr-Aca 5	Low Confidence	Staphylococcus aureus	NZ_CP029649.1	WP_001147662.1	1373486	1373746	-	87	3.5	9.7983	WP_053031056.1\|HTH_17-0-AcrIIA1\|53.1\|4.6e-18	0.394982806	738	-3.4871433	Not found in Prophage	Not found in Prophage	PHAGE_Lactoc_bIL311_NC_002670-gi\|13095666\|ref\|NP_076787.1\|\|9.82e-05	-	MQAFLSEQASQQLANSIVDIAEKIALQKVEQSRKRYLIQKEVMEEYNVTHKVITEWEMMGLRKVKIGKTIRYDRQDIENVIEKMKK	No	No	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus

Showing 1 to 10 of 14 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

Show entries

Search:

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
GCF_003193665.1	NZ_CP029649.1	478724	478909	-	WP_000006110.1	62	0.307313448	353	-2.549277	Not found in Prophage	Not found in Prophage	AcrIIA15\|50.0	MSEYKKKIIELIESNLTGYEISKKTGVSQYVLSQLRQGKREVDNLTLNTTEKLYEYANKVL	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
GCF_003193665.1	NZ_CP029649.1	480647	480871	-	WP_001789892.1	75	0.577424357	206	-1.9416039	45	-1.9416039	AcrIIA15\|53.6	MTKIMNQFKEIYNTIEKLLNDKSISNYRINQDTDVSYGGISELRSGKRKVNNLTLETAEKLYNYQKQLEIMIED	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
GCF_003193665.1	NZ_CP029649.1	2057969	2058160	+	WP_001224379.1	64	0.607959076	265	-2.2052314	Not found in Prophage	Not found in Prophage	AcrIIA15\|35.5	MRKEIEALIFSDVSSYDIYVNTGVNQGLIGDIKDGYLTIDSMPYIDAERLYHFAMERKSLVTN	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus

Showing 1 to 3 of 3 entries

3. CRISPRCasFinder Summary

GCF	NC_ID	CRISPR arrays	Nb CRISPRs	Evidence levels	Cas clusters	Nb Cas	Cas Types/ Subtyes
GCF_003193665.1	NZ_CP029649	NZ_CP029649_1[649777;649862] (evidence-level=1), NZ_CP029649_2[672608;672699] (evidence-level=1), NZ_CP029649_3[869975;870053] (evidence-level=1), NZ_CP029649_4[966475;966552] (evidence-level=1), NZ_CP029649_5[1383770;1383872] (evidence-level=1), NZ_CP029649_6[1524210;1524300] (evidence-level=1), NZ_CP029649_7[1725203;1725450] (evidence-level=1), NZ_CP029649_8[1734173;1735063] (evidence-level=4), NZ_CP029649_9[2127128;2127225] (evidence-level=1), NZ_CP029649_10[2635865;2635945] (evidence-level=1),	10	Nb_arrays_evidence-level_1=9,Nb_arrays_evidence-level_2=0,Nb_arrays_evidence-level_3=0,Nb_arrays_evidence-level_4=1	CAS-TypeIIIA[1725585;1734099],	1	CAS-TypeIIIA (n=1),