Results - Acr-Aca DB

Anti-CRISPR Results - GCF_003812985.1 (Total 0 loci with Aca homologs)

1. Guilt-by-Association

No result on guilt by association

2. Homology Based

Show entries

Search:

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
GCF_003812985.1	NZ_CP033829.1	3212707	3213027	-	WP_123958918.1	107	0.287170187	590	-4.833518	Not found in Prophage	Not found in Prophage	AcrIIA7\|34.7	MNEKVTPPSPAEFTFGLGFGSALDHLKEGRRVARDGWNGKGMFVYLVPPASYAVQTGAAKAHFGEGSMVPYNAYFAIKNVNDTVSTWVPSVNDCLAEDWYVLQEEG	Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia
GCF_003812985.1	NZ_CP033829.1	3213089	3213367	-	WP_123958919.1	93	0.146229545	38	-2.7118857	2	-2.7118857	---	MTQFRKKPVVIEAWPAHELIHAASRDWRALPKAVADAYEKGGWVFQFDGICIPTLEGSMRAERNDMVIRGVQGEFYPCKPEIFAETYDRVEA	Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia

Showing 1 to 2 of 2 entries

3. CRISPRCasFinder Summary

No result on CrisprCasFinder