Results - Acr-Aca DB

Anti-CRISPR Results - GCF_003945425.1 (Total 0 loci with Aca homologs)

1. Guilt-by-Association

No result on guilt by association

2. Homology Based

Show entries

Search:

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
GCF_003945425.1	NZ_AP019306.1	2964199	2964423	+	WP_001795785.1	75	0.564702756	278	-2.0800831	81	-2.0800831	AcrIIA15\|55.4	MTKIMNQFKEIYNTIEKLLNDKSISNYRINQDTGVSYGGISELRSGKRKVNNLTLETAEKLYNYQKQLEIMIEY	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus
GCF_003945425.1	NZ_AP019306.1	1645768	1645959	+	WP_001224379.1	64	0.607959076	303	-2.2052314	Not found in Prophage	Not found in Prophage	AcrIIA15\|35.5	MRKEIEALIFSDVSSYDIYVNTGVNQGLIGDIKDGYLTIDSMPYIDAERLYHFAMERKSLVTN	Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus; Staphylococcus aureus

Showing 1 to 2 of 2 entries

3. CRISPRCasFinder Summary

No result on CrisprCasFinder