Results - Acr-Aca DB

Anti-CRISPR Results - GCF_900475015.1 (Total 7 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Streptococcus gordonii	NZ_LS483341.1	WP_060553059.1	394051	394635	+	195	6	9.8622	Acr	0.241238107	1985	-5.9094334	Not found in Prophage	Not found in Prophage	-	-	MKKGQKLVVLLPLWILVLCGDWAVLSGLVRFSLLEKLILICGTGIGLFFATWGALKSKQNEVRERKIFSIKEKLNGILVLSASSIYTLGIWLSTPPAGLLKEIVMGIGLLVQLVFLGYFILRKADEEADERFYANLSNAAMTAFASSIIFLLTLALLLMIVKGLYIPGGIFFIVAGVLVLLFNFVFMYLESRGA	No	No	Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
Acr-Aca 1	Low Confidence	Streptococcus gordonii	NZ_LS483341.1	WP_060553058.1	394635	394847	+	71	1	7.2039	NZ_LMVP01000224.1_21\|HTH_3\|AcrIIA1\|50.0\|2.3e-14	0.146764567	107	-2.0932434	Not found in Prophage	Not found in Prophage	PHAGE_Brevib_Abouo_NC_029029-gi\|971767218\|ref\|YP_009220108.1\|\|1.99e-12	-	MGKVSNLITSLKSTRESHGMTQQELAERIGVRRETILHLENNRYNPSLEMALKIARVFDLKIEDLFELKE	No	No	Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
Acr-Aca 2	Low Confidence	Streptococcus gordonii	NZ_LS483341.1	WP_060554163.1	1021645	1021974	+	110	7	10.6131	Acr	0.228109063	309	-3.390109	Not found in Prophage	Not found in Prophage	-	-	MNVFLWFLFPMTFMVFIFGIDSFNKLKRMQGRLKSLERNRKGEKTMSRFLKEMIGKKPMITSELIGTNDWLVVDVDEDWVKLSKTDKKGQKKTKLMRIEDIRSVELLEN	No	No	Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
Acr-Aca 2	Low Confidence	Streptococcus gordonii	NZ_LS483341.1	WP_008809497.1	1021986	1022189	+	68	1.5	8.6828	WP_066083800.1\|HTH_3\|AcrIIA1\|40.6\|8.9e-13	0.147564025	241	-3.0509586	Not found in Prophage	Not found in Prophage	PHAGE_Clostr_phiMMP02_NC_019421-gi\|414090412\|ref\|YP_006990525.1\|\|1.45e-08	-	MKLKNRLKELRARDGLNQTELARRAEVSRQTISLLERGEYTPSIIIALKIAHIFGETVENVFRIEEE	No	No	Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
Acr-Aca 2	Low Confidence	Streptococcus gordonii	NZ_LS483341.1	WP_060554164.1	1022186	1022428	+	81	10.5	11.2336	Acr	0.27477927	454	-3.8526564	Not found in Prophage	Not found in Prophage	-	-	MKQLRNNSQLLLLSLFIVYVLSYVLKDAGLLQIELPLRLEWAVVFYLTLAAILDKRISHKRKASGKSSINSRLRDRKGKS	No	No	Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
Acr-Aca 3	Low Confidence	Streptococcus gordonii	NZ_LS483341.1	WP_060553395.1	1243525	1243950	-	142	-4	5.2257	Acr	0.50814354	68	-1.5612524	Not found in Prophage	Not found in Prophage	-	-	MNLNKVIKEIEQLNCKVVILDNLDCKGRYVLANNKHFIFLSSDTTDIEKINILLHEKHHLINDDCNNSLSQIETFKNHIESDTEKGRILDFMSLVNSEYPIDDSFNYQHYISNAEIPVKYENYVKEIATQFYNENKKNNII	No	No	Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
Acr-Aca 3	Low Confidence	Streptococcus gordonii	NZ_LS483341.1	WP_060553396.1	1243953	1244285	-	111	-0.5	5.8909	WP_070677359.1\|HTH_XRE-0-AcrIIA15\|31.5\|3.9e-11	0.093419543	489	-3.9344459	Not found in Prophage	Not found in Prophage	PHAGE_Lactob_iLp84_NC_028783-gi\|971743094\|ref\|YP_009197552.1\|\|2.43e-22	-	MFSSRLKELRQKAKVTQKELAVSINSSQQNIALYEQGKRKPKYETLEKLAVFFNVSTDYLLGKTDILDSDPDIDLDTAINHSVAFDGTPITDDDREAIKNYLKDYFANKK	No	No	Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
Acr-Aca 4	Low Confidence	Streptococcus gordonii	NZ_LS483341.1	WP_060553609.1	1516802	1517017	-	72	-1.5	4.9687	Acr	0.466086168	59	-1.4452536	Not found in Prophage	Not found in Prophage	-	-	MARQVIYNGMSCWLLESEEPFPARVQIISPDDLSKAMQEGFSCWGYPNEIMKEVSTKEYQCLSRHGRFPLN	No	No	Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
Acr-Aca 4	Low Confidence	Streptococcus gordonii	NZ_LS483341.1	WP_045502940.1	1517020	1517352	-	111	-12.5	4.0443	Kang_0021_ST003_A_NODE_11_length_56690_cov_30.441388_49\|HTH_XRE-3-AcrIIA11\|45.8\|0.0092	0.182931038	47	-1.2555679	Not found in Prophage	Not found in Prophage	-	-	MEIEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIAEEFGVSRQAVYDNIKRTEKILEDYEMKLHMYSDYIVRSQILEEIAEKYPEDSFLQEQIATLSSIDNRD	No	No	Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii
Acr-Aca 5	Low Confidence	Streptococcus gordonii	NZ_LS483341.1	WP_045634891.1	1585339	1585866	+	176	10	10.2133	Acr	0.080430924	1860	-5.752824	Not found in Prophage	Not found in Prophage	-	-	MKIKSKNQFLTMTALLTALAIAIPMVMPLKIVIPPASYTLGSHVAIFLAMFISPLMTVIVILGSTYGFLIAGYPFVIVLRAFSHIVFGTLGAIYLKKAPETLNNPIKKWIFNIVMAIIHALGEVVVCVIFYSSTAYPSGNLFYLLFILVGFGTIIHSIVDFLISDFIFQALKKIR	No	No	Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii

Showing 1 to 10 of 15 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

Show entries

Search:

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

GCF	NC ID	Start	End	Strand	Protein ID	aa Length	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	Acr_Hit\|pident	sequence	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
GCF_900475015.1	NZ_LS483341.1	1272353	1272556	+	WP_008809313.1	68	0.405931998	40	-1.1062388	Not found in Prophage	Not found in Prophage	AcrIIA15\|43.1	MRKQIEKLLNSDISTSAIAKGAGVPWSTVADLRKGKTSIDKMALLTAEKLNDFAEELEAEKDDEFYN	Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus gordonii

Showing 1 to 1 of 1 entries

3. CRISPRCasFinder Summary

GCF	NC_ID	CRISPR arrays	Nb CRISPRs	Evidence levels	Cas clusters	Nb Cas	Cas Types/ Subtyes
GCF_900475015.1	NZ_LS483341	NZ_LS483341_1[825545;825617] (evidence-level=1), NZ_LS483341_2[1225634;1225719] (evidence-level=1), NZ_LS483341_3[1271072;1272295] (evidence-level=4),	3	Nb_arrays_evidence-level_1=2,Nb_arrays_evidence-level_2=0,Nb_arrays_evidence-level_3=0,Nb_arrays_evidence-level_4=1	CAS-TypeIIA[1264980;1270981],	1	CAS-TypeIIA (n=1),