Results - Acr-Aca DB

Anti-CRISPR Results - GCF_900638385.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Medium Confidence	Actinobacillus delphinicola	NZ_LR134510.1	WP_126600033.1	1342706	1343014	-	103	9.5	10.3514	Acr	0.361020759	129	-3.4027524	Not found in Prophage	Not found in Prophage	-	-	MRKMTRKECVARLLLDYPHGITEGDIIKAYHFLNGRNEANRIEQLLGISLQRTTVEGITGSRYTRYAIGNKEDASKVLRYSNQLTAKRKGTPIHESTLSKFY	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus delphinicola
Acr-Aca 1	Medium Confidence	Actinobacillus delphinicola	NZ_LR134510.1	WP_126600893.1	1343024	1343218	-	65	8	11.2257	WP_102034228.1\|HTH_17-2-AcrIC1\|43.8\|0.00062	0.345024359	652	-4.853052	Not found in Prophage	Not found in Prophage	-	-	MTITVTTSNRLLSIKELEAMGFGSRSKIDRMVKQGLLKRIKIGFSTRFYESDIKAFLAKGKQSN	No		Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales; Pasteurellaceae; Actinobacillus; Actinobacillus delphinicola

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

Show entries

Search:

GCF	NC_ID	CRISPR arrays	Nb CRISPRs	Evidence levels	Cas clusters	Nb Cas	Cas Types/ Subtyes
GCF_900638385.1	NZ_LR134510	NZ_LR134510_1[167795;168556] (evidence-level=4), NZ_LR134510_2[174614;174913] (evidence-level=4),	2	Nb_arrays_evidence-level_1=0,Nb_arrays_evidence-level_2=0,Nb_arrays_evidence-level_3=0,Nb_arrays_evidence-level_4=2	CAS-TypeIIU[168769;173293],	1	CAS-TypeIIU (n=1),

Showing 1 to 1 of 1 entries