CAZyme Information: MGYG000000009_00836

Basic Information

• Species: Ligilactobacillus murinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus murinus
• CAZyme ID: MGYG000000009_00836
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		50454.89	9.3203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000009	2219792	Isolate	United Kingdom	Europe

• Gene Location: Start: 24036; End: 25424 Strand: +

Full Sequence      

MEQIQGYQFAIDLNDNGMTRSLRSLRDEAKLLRSAMQANFAEVRSGEGIMAAYANKIEDA
KRAIEGQRVYIERLKKEQDGLDLSTDKGRQAYVKYENQINTAKRAIANLEAQEKRATNAL
NTHKSGVLQLRDAVETSKRVNENYVTQLEAEGRKYAAQQAKVKGLIDVRKKMGEQLSAEK
GLLAQVEQTSGKMSKAYQEQAVRVAELSTKYVQNEKAIRESNVKTLDMSNTMIKFRDKVG
SAGETAKNAFNKIKEHAYLAAGTVGALGKLSIDGAKKASEVSSQYQVIYNNLITSGESAA
EATEKVKQMQEDGVKYSVKYGISQKEIADGYLELVKRGYSSTQALGAMNTELQGSIASGD
DFSDVIKVASQTLEGFQMNVDKSGNPLKSVAEMSKQTKIAVNELAYTADVTSTDFQSLGK
GMEYVNSTAHQAKFSLSETSAAMGILSNNGLEADKALVKLAA

Enzyme Prediction     

No EC number prediction in MGYG000000009_00836.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10145	PhageMin_Tail	1.04e-15	310	456	1	133	Phage-related minor tail protein. Members of this family are found in putative phage tail tape measure proteins.
COG5283	COG5283	2.24e-15	1	422	3	401	Phage-related tail protein [Mobilome: prophages, transposons].
TIGR01760	tape_meas_TP901	9.20e-12	300	456	31	173	phage tail tape measure protein, TP901 family, core region. This model represents a reasonably well conserved core region of a family of phage tail proteins. The member from phage TP901-1 was characterized as a tail length tape measure protein in that a shortened form of the protein leads to phage with proportionately shorter tails. [Mobile and extrachromosomal element functions, Prophage functions]
TIGR02168	SMC_prok_B	0.001	2	149	789	932	chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]
COG1196	Smc	0.004	20	227	737	944	Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANK66596.1	2.37e-137	1	456	1	449
ANK60023.1	3.21e-136	1	456	1	449
ANK66921.1	3.21e-136	1	456	1	449
ANK63359.1	5.05e-136	1	455	1	448
ANK69636.1	5.05e-136	1	455	1	448

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E7DNB6	1.07e-06	299	456	85	228	Tape measure protein OS=Pneumococcus phage Dp-1 OX=59241 GN=TMP PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000009_00836.