CAZyme Information: MGYG000000003_00784

Basic Information

• Species: Alistipes shahii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes shahii
• CAZyme ID: MGYG000000003_00784
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000000003_2|CGC2	43183.26	4.8563

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000003	3229518	Isolate	United Kingdom	Europe

• Gene Location: Start: 75913; End: 77064 Strand: -

Full Sequence      

MLLALLLSGVACSDDSEGPKKEGESDPVTLTLSDPNATEETKALYSNLWAIQSKGFMFGH
HDDLMYGRTWYGTEGGSDTKAVCGDYPAVYSFDFAEHIDDRHASDPDAQALRLRCCREAY
DRGMVLTSCIHINNPLTGGDSWDNSSNRVAAEILTEGSATNRTFKEWLDRLADIAHNLRG
SDGKLIPVIFRPFHEHTQTWSWWGASCTTTEEFVNLWKFTVKYLRDTKGVHNFIYAISPQ
MDSAKTVDDFYFRWPGDEWVDFVGMDCYQGINNAVFVTNLKAISKVSLAKLKPCGVTETG
VEGFTATDYWTTNIHAPLTGRRVSMVVTWRNKYDPMESGTHYFSVFPGHPSERDFVKMYN
QENSFFCSDLPDMYTPAENVTVL

Enzyme Prediction     

No EC number prediction in MGYG000000003_00784.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	33	362	3.3e-61	0.9735973597359736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.57e-35	34	268	2	230	Glycosyl hydrolase family 26.
COG4124	ManB2	3.48e-15	131	309	128	303	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB80106.1	1.51e-189	1	382	10	387
ALJ40168.1	1.43e-174	12	382	22	392
QUT88729.1	7.42e-174	6	382	12	389
ALJ60278.1	2.12e-173	6	382	12	389
QUT31668.1	4.65e-171	1	382	8	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	1.26e-76	38	374	9	343	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	3.04e-66	8	374	10	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	3.04e-66	8	374	10	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	5.55e-66	8	374	33	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	2.36e-65	8	374	10	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	8.48e-52	2	374	22	415	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	4.36e-37	29	303	39	321	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	2.70e-13	29	300	28	294	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	8.57e-11	32	310	146	422	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	4.07e-08	28	268	170	394	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.047255	0.949470	0.002448	0.000327	0.000237	0.000230

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000003_00784.