CAZyme Information: MGYG000000003_00270

Basic Information

• Species: Alistipes shahii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes shahii
• CAZyme ID: MGYG000000003_00270
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
733		81109.97	6.3755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000003	3229518	Isolate	United Kingdom	Europe

• Gene Location: Start: 296732; End: 298933 Strand: -

Full Sequence      

MKKITVIALLLAAALGAQARNGSGKPAYKDASRPVEERVSDLLSRMTLEEKVMQLNQYTL
GRNDNANNVADPVDKIPAEIGSLIYFDTSPELRNRLQKKAIEQSRLGIPVLFGYDVIHGF
RTTYPISLAQACSWNPALVKQAAEVAAQEARMSGVEWTFSPMIDVARDGRWGRVSEGYGE
DPYANAVYGVAAVEGYQGNNLADSRRVAACLKHFVGYGASEAGRDYVYTEISRQTLWDTY
MPPYQAGIEAGAATVMSCFNDISGTPGTANPYILTEVLKERWAHDGFVVSDWAAIEQLRS
QGVAADRKEAAEKAFNAGVEMDMMNRCYDAHLAALVREGKVSQEKLDEAVRRVLRLKFRL
GLFERPYTPESEETDRFLLPASLAVAERLAEESMVLLKNENNTLPLKAARRIAVIGPMAQ
NRLHLLGAWSAHGREEDAVSLFAGLENEYRGRAELLYARGCDFDGEDRSGFREAVAAAAA
ADVVVLCLGEKKQWSGENASRSTIALPEIQEQLAAELAQTGKPLVLVLSSGRPLELCRLE
PLCGAMVQMWQPGIRGGNPLAGILSGRINPSGRLAMTFPRSTGQIPIYYNRRQSGRTHQG
KYQDIPSTPLYEFGHGLSYTTFEYGDLRPSATTLRRGEKTTVEVSVTNTGGMDGAETVHW
FISDPVCRISRPVRELKHFEKQPIRRGETRTFRFEIDPEKDLSFTDGDGNRFLEPGDYFI
LVKDKKVKLTLTD

Enzyme Prediction     

No EC number prediction in MGYG000000003_00270.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	102	324	9.2e-70	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	39	728	38	758	beta-glucosidase BglX.
COG1472	BglX	8.07e-99	46	462	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.36e-79	47	356	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	4.91e-76	76	731	49	777	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	6.63e-54	394	619	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63996.1	0.0	1	733	1	733
AZI28033.1	0.0	1	733	1	731
QPH41751.1	0.0	26	733	24	731
QUU00468.1	0.0	1	733	1	736
QUT62248.1	0.0	1	733	1	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	2.70e-174	27	722	2	737	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.52e-173	27	722	2	737	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	1.63e-173	39	730	13	746	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	1.78e-161	36	722	4	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	9.20e-161	23	722	27	750	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	3.00e-168	39	728	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.35e-167	39	722	38	750	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	1.04e-120	1	722	1	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	1.20e-117	35	725	35	764	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH9	9.42e-110	28	727	29	745	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000230	0.999085	0.000204	0.000154	0.000158	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000003_00270.