CAZyme Information: MGYG000000026_00779

Basic Information

• Species: Catenibacterium mitsuokai
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Catenibacterium; Catenibacterium mitsuokai
• CAZyme ID: MGYG000000026_00779
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	MGYG000000026_13|CGC1	54476.71	5.0876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000026	2527406	Isolate	United Kingdom	Europe

• Gene Location: Start: 15407; End: 16822 Strand: +

Full Sequence      

MRKDFLWGGAVAAHQVEGGFNEGGKGPNVSDMMTVGSATTRRKITKTIEPDEFYPNHTAI
DFYHHYKEDIALFKEMGFKCFRTSISWARIFPMGDEETPNEEGLKFYDDMFDELLKNGIQ
PVITLSHFEMPYHLVEKYGGWRNRKMITFFVRFAKVCFERYHNKVKYWMTFNEINNQANY
EADVAVFTNSGIIFEEGEDKERTVYQAAHYELVASAMAIKEGHAIDPSMMIGCMIAMTPI
YPYSCNPDDMLKAVGANHKRFWYMDVHARGRYPGYMKSFFERKNFNLDITEEDLAVLPQG
TVDYIGFSYYMSFAVKGDGDVNLDYNEETDLCDNPYISKTEWGWPIDAKGLRYSLNWMYD
RYNLPLFIVENGFGAVDQMVDGKVHDQYRIDYLKAHIEEMKNAVDIDGVDLLGYTVWGCI
DCVSFGTGEMKKRYGFIYVDKDNAGQGTLARSKKDSFEWYKKVIESNGEKL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	468	1.2e-152	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	471	4	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	471	6	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	3	471	8	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	3	469	6	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	2	471	7	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL57335.1	2.25e-304	1	471	1	472
QUN12427.1	1.40e-291	1	471	1	472
CCO09677.2	1.38e-255	1	471	4	476
ATF72753.1	2.64e-253	1	471	4	476
QKN80918.1	5.33e-253	2	471	5	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	2.32e-235	3	471	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	6.65e-235	3	471	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.87e-227	3	471	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
2XHY_A	4.62e-223	3	471	10	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3QOM_A	1.34e-220	5	471	15	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	2.53e-222	3	471	10	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	2.62e-217	1	471	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	4.04e-185	5	471	12	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	3.01e-171	3	471	6	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	3.11e-163	3	471	9	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999990	0.000048	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000026_00779.