CAZyme Information: MGYG000000035_03161

Basic Information

• Species: Blautia_A hydrogenotrophica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A hydrogenotrophica
• CAZyme ID: MGYG000000035_03161
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	MGYG000000035_7|CGC2	63471.34	7.671

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000035	3529525	Isolate	United Kingdom	Europe

• Gene Location: Start: 262225; End: 263949 Strand: -

Full Sequence      

MTKQEFINQIAGYVQKYAPQYGIKCCSAVIAQAILESGWGESRLAAQYHNYFGLKCGTKW
TGPSVNMTTQEEYESGSLTTIKDNFRVYDSMDEGVKGYFEFIQLSRYQNLKGITDPRIYL
ETIKADGYATSSSYVENNMALVNQYGLTKYDKEGTGMYSKNDAINRAISIASGEIGYLEK
RSNSQLDDKTANAGSNNYTKYWRDVYPAYQGQAWCAAFVSWVLMQAFDKTTATKLLKHWP
YVYCPTLGSLFTQYANPEVGDIVIFYRGGTFAHTGIVTSVVGDRFETIEGNTSGASGVIA
NGGGVCAKSYFNSKLPGTKFCRVDWNAAAAWMDEHLGNTPQKDYLCEGDQGKTVKAYQKN
LIKIGYNCGKNGADGDFGPATKAATVEFQGDYGLEQDGNAGPATQAKLNAEVKKKGQTQK
GFARFVGEVQKTCVVHEAAKKASPAITGYPKLVPGNLVDVLGRYGYQDGWYKVCIADEHI
GYVWADSVKPVDTEAYKDNRTEQGFARFVGEVQKTCVVHLEPKKASDAITGWPKLVKGNR
VDVLGRDGYEDNWYKVCVADQYIGYVWADSIKRV

Enzyme Prediction     

No EC number prediction in MGYG000000035_03161.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	13	147	1.3e-30	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	5.11e-39	3	152	43	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	9.15e-22	1	151	158	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	1.01e-21	4	151	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.65e-19	11	98	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	2.10e-18	4	134	153	286	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFB75729.1	3.38e-83	1	297	1	300
QRT30096.1	2.41e-72	1	291	1	290
QEI31358.1	1.95e-70	1	291	1	290
QHB23853.1	1.95e-70	1	291	1	290
AFB75826.1	3.22e-66	1	176	1	175

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	5.74e-17	4	143	2	144	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	7.12e-17	4	143	3	145	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	4.52e-16	4	143	3	145	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN5_A	5.83e-13	1	144	1	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	5.94e-13	1	161	1	162	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	5.99e-15	3	159	48	206	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9I4P4	6.23e-15	2	144	238	384	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P58231	4.54e-11	6	144	152	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	4.54e-11	6	144	152	293	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P39046	8.10e-11	6	156	65	219	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000035_03161.