CAZyme Information: MGYG000000105_01604

Basic Information

• Species: Bacteroides clarus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides clarus
• CAZyme ID: MGYG000000105_01604
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	MGYG000000105_3|CGC3	27807.21	8.5594

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000105	3966085	Isolate	Canada	North America

• Gene Location: Start: 79594; End: 80301 Strand: -

Full Sequence      

MVPKIIHLCWFSNDPFPVEIKICLESWKRVLPDYTIRRWTYEDARAIGCRYINEALEEKK
WAFAADVVRFYSVYKEGGIYMDSDMFVKKRFDEFIPEHGFASFHEHISTTVKLQAAFLIG
EKGNKFCEDVFSYYKQRSFFLPDGTYDLKISPDVMVEIAREKGYKAEDVEQHLADDTVIY
PGYFVTPCNTHTIKHPDAFARHMVYGSWKKHKLGRKFEKLMKHIVLLVRFALFKR

Enzyme Prediction     

No EC number prediction in MGYG000000105_01604.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	97	2.6e-18	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.19e-15	1	111	81	193	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.57e-10	17	101	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.09e-06	3	137	47	195	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49969.1	5.41e-126	1	235	1	232
AVM53007.1	4.46e-104	1	235	1	232
AVM58066.1	1.81e-103	1	235	1	232
CBK68805.1	4.55e-49	1	227	1	250
QUR43722.1	4.55e-49	1	227	1	250

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000105_01604.