CAZyme Information: MGYG000000107_03762

Basic Information

• Species: Klebsiella_A oxytoca
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A oxytoca
• CAZyme ID: MGYG000000107_03762
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	MGYG000000107_6|CGC5	73259	9.0038

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000107	5859765	Isolate	Canada	North America

• Gene Location: Start: 293856; End: 295793 Strand: -

Full Sequence      

MEKAKTVTWRLLAAGVSLLTLSQLAHADSLDEQRSRYAQTKQAWDNRQMDVVNQLMPTLT
TYPLYPYLQYRQITDDLMNQPALVVTNFIAANPTLPPARSLKSRFVNELARRDDWRGLLA
FSPEKPTGTEAQCNYYYAKWNVGQTQEAWDGAKALWLSGKSQPNACDRLFGAWRASGQQD
PLAYLERIRLAMKAGNTSLVRVLAQQMPSDYQTIATAVIALANDPNSVMTFARTTGATDF
TRQMAAVAFASVARQDVENARLMIPSLAQAQQLNEDQIQELRDIVAWRLMGSDVTEEQAI
WRDDAIMRSQSTSLVERRVRMALGLGDRRGLNTWLARLPMEAKEKDEWRYWQADLLLERG
RDDEAKDILRSLMQQRGFYPMVAAQRLGEEYTFRIDKAPANLDPALTSGPEMARVRELMY
WNMDNTARSEWANLVTSKTKDQQAQLARYAFNQNWWDLSVQATIAGKLWDQLEERFPLAY
NDLFKRYISGKDIPQSYAMAIARQESAWNPKAGSPVGARGLMQIMPGTATHTVSMFSIPG
YSGPSQLLDPEMNINIGTSYLQYVYQQFGNNRIFASAAYNAGPGRVRTWRGNSGGRIDAV
AFVESIPFSETRGYVKNVLSYDAYYRYFMGQKDALLSDAEWKLRY

Enzyme Prediction     

No EC number prediction in MGYG000000107_03762.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	498	622	2.4e-31	0.7555555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	0.0	1	645	1	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	1.48e-66	475	627	1	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	9.42e-50	346	638	1	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	1.74e-42	477	621	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.01e-38	484	600	1	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APB47039.1	0.0	1	645	1	645
AVL80801.1	0.0	1	645	1	645
AKL06495.1	0.0	1	645	1	645
QSS39630.1	0.0	1	645	1	645
AKL23420.1	0.0	1	645	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	0.0	28	645	1	618	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	0.0	28	645	1	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5OHU_A	3.67e-90	18	645	13	638	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	4.26e-87	32	645	1	610	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FBT_A	7.57e-87	33	645	1	609	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	0.0	1	645	1	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	0.0	1	645	1	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	0.0	1	645	1	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	1.73e-71	272	640	227	587	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P39433	2.12e-17	604	645	1	42	Soluble lytic murein transglycosylase (Fragment) OS=Enterobacter cloacae OX=550 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000469	0.998463	0.000415	0.000227	0.000208	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000107_03762.