CAZyme Information: MGYG000000140_01124

Basic Information

• Species: UMGS1375 sp900066615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1375; UMGS1375 sp900066615
• CAZyme ID: MGYG000000140_01124
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1379		154097.7	4.3368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000140	3539979	Isolate	United Kingdom	Europe

• Gene Location: Start: 154256; End: 158395 Strand: +

Full Sequence      

MKKKWWAASLAVAMVITSVPAIPAAVYAAEPMLIEAEDYSSYSGKLKVMTNNKNASGGKY
VGDFDNLDCLSYKIQIEKAGNYQITLTVGTKQDGGIALLNCGGNVSEKISIPNTKNWNTY
RDVTATLWLDEGEQVLTVSNMGATWNIDKLTLTYVDSEKTADEQQSYQKVHMENRWKSQR
ITEQNGSIAYADTGTEAYDTEASLWNLIPNEDGWYTIQNVSTGNYMILKGENQETVPSEN
GNVQEEGQWKIGNINGYLVFYNRKYPKCGLNVEYQSQYPGKVTATGDTLIKWYSAQWKLN
TPAKEHTYEILGDRIEGTAGLAVSKDGKSITVSQQGEKKEWTLSQDVSGEPIFEAKNMPI
MEAVYNLSIEESLLNINDGLYGKVFWTGTNWHKVWTRDTAMSVQYSLAWIFPEETKNSIL
EKIVGGTENPRVWEEDTGTGGSYPNSVDRIIMEIAGFELYKTTGDKEFLEKIYEISKNTL
EQDYHVAYDEQSGLFKGETGGLDHRSKTYPDWMDEREQNSIYNITESKAANANIIFAQAL
QIMEESAEILGKDESEVKEWNRRYESLKKAINEHFWLEERKMYASWEYPQYMGSPVADKV
DVIANGYALLSDVASESQKQQIMENYPLVIYGADTVWPQKNGRQASAIYHNRGVWPGWET
AMMIGAKENGNLQLADEIFKSCVRGAGMSLTNKEVINFETGEGVHSDRQLWSIAGTLAGY
YRVLFGMNYDTDGILFTPYVPEWMNGPFVLKNYKYRNAVLNLTVSGKGDTLESITVNGEE
KPLDYVLPADASGTYEIVMKVSDSGKRSKIHLEEDSFAVCPDMPVLTEESDGRLTWDENP
DYTYKLWTGSEYVPVSSGSYQPDRSKYGTYSLVATDQNGVTSEMSKPIMVSPENSKLVYE
AEDGTYNAENFENTAQGYSGRGYVVDFLDRKTDLAIEVDVLQSGNYQLSMIYNNYGNATT
GQDCAMRSVYVDGKEIGTLIFPIVNFDFQQSPHLYVNLEKGKHTVEIRYNVSDWYDTNMA
TIRGTKKNSVSYDSLTLQYLGERKGKGETAAKGLDQIITMLENLDDSQYTDESWKDLETA
VKEAKAVWANEHSSQKELDQALDALLKTFGNLEYAVQKVHLEVAVQTAEQLLAEAVNYED
MDALQMAVEEGKALLSNTAATQEEADQAAERILTLLAKSSKKADVKSLESLIEQANKFTN
EKFTSGSFKNLQDQIEKAEAVLSNTEREEDEIAKAYEELLQAIIGLERKANKAALQAVIA
RAEAVLASSDCYTASTLDGLEELLADAKEVYQKEDAVQQEVNEAVKSLTLKVAEARLKGD
VDGNGKIGTSDSVLLLQYAAEMTVLDEISAESADVNGDKAADTQDAVWILQYASEKTEQ

Enzyme Prediction     

No EC number prediction in MGYG000000140_01124.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM6	35	153	5.5e-20	0.8623188405797102
CBM35	899	1018	4.8e-19	0.9411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04080	CBM6_cellulase-like	1.25e-18	31	153	2	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
cd04086	CBM35_mannanase-like	1.42e-14	898	1016	2	112	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
smart00606	CBD_IV	1.06e-12	34	148	8	125	Cellulose Binding Domain Type IV.
pfam17389	Bac_rhamnosid6H	1.20e-12	454	637	105	309	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	5.10e-11	391	763	281	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEH83785.1	8.98e-208	308	1044	31	770
QUT75824.1	2.55e-138	167	1020	24	868
QEC45824.1	6.41e-126	193	1023	44	871
AFG37033.1	1.11e-111	308	1013	51	762
BAX82401.1	3.34e-104	340	1008	214	864

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55298	1.22e-08	896	1014	20	128	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55296	2.60e-07	888	1014	13	129	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000320	0.998856	0.000170	0.000245	0.000204	0.000182

TMHMM  Annotations     

start	end
5	27