CAZyme Information: MGYG000000168_01173

Basic Information

• Species: Butyricimonas sp003479425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas sp003479425
• CAZyme ID: MGYG000000168_01173
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461		53149.6	5.5252

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000168	5206610	Isolate	China	Asia

• Gene Location: Start: 288682; End: 290067 Strand: +

Full Sequence      

MYIIRNITYTLSLLLCLASCKTKEEDPLIIPEPTTLEQIDQRGVLNVCSYYNTTDYYVYK
GIPKGFHYELVKDFADYLGVKLNIEVNSNIEESIQKLNEGKYDLIAMSLAITDARKEQVR
FVHPLFSTSRVLVQYKSDSIIQSVQDLKNKEIFIQEGTSNTKFLQQLNDSLQLNLKITEL
EDVTYEDILLKVENGELPFTVIDKNVAQIAAQYMKHIDYSLQLSTDGPVSWAVAGKAVLL
NEEINAWLDPIKKSEKFNVLYNRYFKSSYITSLHNSKYYKLKNGVISSFDPIIKEEAKKI
GWDWRLLAAVIYQESGFDPEATSHLGAVGLMQVMPETSIQLGFEDYQEPQDNIKVGAYYL
KYLEKMFSKLDLDTLNQTKFTLAAYNAGPGHVFDAMRLAESYGKNPKVWDNNVDYFLLHK
SQPELYRDSVVRFGYCDGRQTFRFVNNIIENYTHYKNTIPR

Enzyme Prediction     

No EC number prediction in MGYG000000168_01173.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	295	456	1.9e-29	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10859	PRK10859	6.18e-94	32	448	32	443	membrane-bound lytic murein transglycosylase MltF.
cd13403	MLTF-like	3.17e-79	293	457	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	4.29e-69	27	448	7	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd01009	PBP2_YfhD_N	1.48e-65	43	266	1	223	The solute binding domain of YfhD proteins, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes the solute binding domain YfhD_N. These domains are found in the YfhD proteins that are predicted to function as lytic transglycosylases that cleave the glycosidic bond between N-acetylmuramic acid and N-acetylglucosamin in peptidoglycan, while the YfhD_N domain might act as an auxiliary or regulatory subunit. In addition to periplasmic solute binding domain, they have an SLT domain, typically found in soluble lytic transglycosylases, and a C-terminal low complexity domain. The YfhD proteins might have been recruited to create localized cell wall openings required for transport of large substrates such as DNA. They belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.
cd16896	LT_Slt70-like	2.36e-31	292	392	7	109	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51446.1	4.67e-287	1	461	1	461
AZS31450.1	1.01e-283	1	461	1	460
SNV38074.1	1.72e-161	4	457	3	459
ADY33137.1	1.72e-161	4	457	3	459
BAX80407.1	2.08e-117	24	459	34	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OYV_A	3.81e-51	33	452	8	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OZ9_A	2.40e-50	33	452	1	418	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	2.80e-50	33	452	8	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA2_A	5.24e-49	33	452	42	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA1_A	5.24e-49	33	452	42	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_B Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	1.91e-62	35	452	33	445	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q4KHS7	3.06e-61	30	452	28	448	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mltF PE=3 SV=2
Q3KHL5	1.38e-56	30	452	28	448	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mltF PE=3 SV=1
A4SNZ5	4.91e-54	36	452	40	450	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
B1JDH3	7.61e-54	30	452	28	448	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain W619) OX=390235 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.001101	0.998931	0.000000	0.000001	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000168_01173.