CAZyme Information: MGYG000000168_01187

Basic Information

• Species: Butyricimonas sp003479425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas sp003479425
• CAZyme ID: MGYG000000168_01187
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307		35375.76	6.7761

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000168	5206610	Isolate	China	Asia

• Gene Location: Start: 306641; End: 307564 Strand: +

Full Sequence      

MKNILLIFLTILVLLNSAAIGYYIYEDKLDQPENDLPVFHVMKTSDVEFPDKFSLAGERV
PLERIDVTEAFKKELIVNTYLHSHTIQVLKHAPRYFHTIEPILKEEGVPDDFKYLAVIES
SLNPLAVSYAGAVGIWQLMSGTAKELGLEVSNDVDERYHLEKATRAACAYLKKAYQKFGS
WTLAAASYNGGMNMLSKQQDRQKETNFYDLLLGEETGRYVYRLLALKQIMEEPHLYDFYV
EQLYPVEPVTLVKVTQSIKDLAEFAKEHGISYKTLKRFNPWLRQTSLKIGKHKTYYIAIP
ENKEAYK

Enzyme Prediction     

No EC number prediction in MGYG000000168_01187.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	95	239	5.9e-24	0.9703703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.38e-62	103	228	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	6.05e-29	99	210	2	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	6.04e-25	79	303	92	314	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	1.11e-19	115	225	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.87e-14	93	225	3	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51442.1	3.98e-190	2	307	3	308
AZS32129.1	2.30e-189	2	307	3	308
ADY32428.1	1.05e-120	45	307	49	311
SNV32652.1	1.05e-120	45	307	49	311
AHW59007.1	7.31e-102	47	301	46	302

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	8.28e-24	51	301	58	309	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	8.28e-24	51	301	58	309	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	3.13e-07	80	191	10	122	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
O31608	5.58e-07	119	191	85	152	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.649417	0.337247	0.010119	0.000846	0.000591	0.001774

TMHMM  Annotations     

start	end
5	24