CAZyme Information: MGYG000000217_00779

Basic Information

• Species: Acetatifactor sp900066565
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900066565
• CAZyme ID: MGYG000000217_00779
• CAZy Family: CE19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		41313.94	4.8107

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000217	3653823	Isolate	China	Asia

• Gene Location: Start: 178723; End: 179808 Strand: +

Full Sequence      

MEQADTIIQIPHFYGSLRGMQDKFDKYARQDAFTGSTREEWEAWKETSRETLKDLLGWKY
METCDLAPRVEEVVELENGIRREKVILQVEPEVYMPMYILIPPKQNEGKQKCFLALPGHQ
GAGKFSVAGRDDIPAVKRMIEFYHYDYGMQLAKRGYVAICPDCRGFGERRDEALQKGTDE
KSFLTSTCFHLAHMAEPLGETVAGMCTWDASRLIDYVYERGEWDTEDLGVMGFSGGGMQT
LWVSALDDRVKKCIISGYLYGYRDALLLLNGNCSCNYVPHLWEHFDMGDIASLIAPRPLA
VQSCRDDHLNGPRGLVNVTEQLDIVREAYSLYGKEEYPIHDVREGDHCWHEEVLDIALPR
L

Enzyme Prediction     

No EC number prediction in MGYG000000217_00779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE19	36	336	1.6e-33	0.7710843373493976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0412	DLH	4.18e-06	146	267	45	152	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
pfam00326	Peptidase_S9	0.001	143	258	1	96	Prolyl oligopeptidase family.
COG3458	Axe1	0.002	209	252	159	202	Cephalosporin-C deacetylase or related acetyl esterase [Secondary metabolites biosynthesis, transport and catabolism].
COG1506	DAP2	0.007	145	267	412	521	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC03567.1	8.29e-120	8	347	350	691
ATP54718.1	2.10e-112	8	347	356	697
QIA34433.1	1.06e-107	20	347	368	697
VIP10631.1	2.42e-18	37	353	60	350
QEL18493.1	2.47e-18	36	336	51	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NUZ_A	5.45e-08	75	333	85	335	Crystalstructure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343],3NUZ_B Crystal structure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343],3NUZ_C Crystal structure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343],3NUZ_D Crystal structure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343],3NUZ_E Crystal structure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343],3NUZ_F Crystal structure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution [Bacteroides fragilis NCTC 9343]
7B7H_A	9.59e-06	150	344	177	382	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34973	8.73e-17	61	325	24	262	Putative hydrolase YtaP OS=Bacillus subtilis (strain 168) OX=224308 GN=ytaP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000217_00779.