CAZyme Information: MGYG000000234_00718

Basic Information

• Species: Vagococcus teuberi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Vagococcaceae; Vagococcus; Vagococcus teuberi
• CAZyme ID: MGYG000000234_00718
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209	MGYG000000234_1|CGC7	23697.17	6.8724

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000234	2257969	Isolate	China	Asia

• Gene Location: Start: 739292; End: 739921 Strand: -

Full Sequence      

MAKKYARRKKTRYKLTLPILVGALLLMVSMVVFLLSLRGLTSPTQTIQSEETNTTNKQDF
IDEIVPVAKEMQTSHGIMPSIILAQAILESDWGTSELSAKYNNLFGIKSFSPNDHSIKLE
TKEYKDGKWETIKANFKVYASWSDCIRDHTLLFVQGVDWDPYLYQGVLLADDYQTAAKAL
QVAGYATDPGYADKLVSLIKQYQLDQYDH

Enzyme Prediction     

No EC number prediction in MGYG000000234_00718.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	65	204	7.9e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.14e-67	25	208	11	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	2.27e-37	58	208	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	3.96e-36	58	208	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK08581	PRK08581	3.22e-34	50	209	313	473	amidase domain-containing protein.
PRK05684	flgJ	4.30e-29	39	201	134	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APB31772.1	1.08e-129	1	209	1	209
QIL49718.1	2.66e-86	32	208	10	187
QNN73650.1	7.65e-86	6	208	2	208
AQP54307.1	5.06e-81	7	208	4	206
AYW45165.1	2.53e-68	6	208	2	202

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.19e-27	55	208	28	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.34e-20	58	208	61	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	2.40e-20	56	201	2	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.41e-20	56	201	2	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	4.32e-16	58	206	2	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.86e-44	6	208	2	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	2.36e-24	45	208	50	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	4.55e-24	45	208	50	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	1.61e-23	45	208	50	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	1.69e-21	56	208	61	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35