CAZyme Information: MGYG000000265_01549

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_01549
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000000265_4|CGC6	42724	8.4048

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 352874; End: 353983 Strand: +

Full Sequence      

MSTKVLYIIIFTIFASTSVAQNRILKKFPEGYTPEEVGIKVANRFLSGKHMLHGGKWIHY
AEVCTWYGAVRFASESKNKELSRQLQERFDFLCTAERDFLPIKNHVDLNMFGCLPLEFYL
ITKEMQYLDLGISYADTQWELPAEASAEEKRWADKGLSWQTRLWIDDMYMITILQSQAYR
ATGNRKYIDRTARSMAVYLDELQRPNGLFYHAPDVPFLWGRGNGWMAAGMAELLKVLPKD
NPDRPRILQGYLDMMKSLKQYQAENGMWNQLIDAPDCWNETSGTAMFTYAMITGVKQGWL
KAREYAPAVRKAWLSLVSYINENGDVTEVCSGTNKRNNRQYYYDRPKKTGDYHGQAPVLW
CAFALMENK

Enzyme Prediction     

No EC number prediction in MGYG000000265_01549.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	365	2.8e-73	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	6.07e-49	65	362	34	336	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.68e-41	59	359	35	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDW23918.1	4.96e-189	1	368	1	368
QDO68160.1	6.13e-185	20	368	19	367
ALJ59885.1	6.36e-185	19	368	19	368
QUT89090.1	6.36e-185	19	368	19	368
QUT89086.1	3.53e-184	20	368	19	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	5.63e-34	163	360	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	7.41e-24	56	359	38	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.15e-23	56	359	28	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	6.57e-20	164	313	158	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.56e-18	164	313	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.06e-23	56	359	38	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
T2KPL9	3.36e-17	148	326	141	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	2.06e-16	126	326	132	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	5.03e-15	57	329	92	378	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
P0A3U6	1.60e-08	180	359	11	222	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999124	0.000153	0.000145	0.000138	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_01549.