CAZyme Information: MGYG000000280_01734

Basic Information

• Species: AM51-8 sp003478275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AM51-8; AM51-8 sp003478275
• CAZyme ID: MGYG000000280_01734
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
902	MGYG000000280_3|CGC7	104202.08	4.6529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000280	2599910	Isolate	China	Asia

• Gene Location: Start: 291427; End: 294135 Strand: -

Full Sequence      

MSFWTNIKSKFNTTEKQDAVIYHIDSLVNDDGKMSVKGWIFSTQMDLKQIQIILSQPQRE
QVIEVPLTFRKDIVDVFSLSVGTKTAFEFTLAYESADTTDVFLQYAKEAGKERKLLCTLS
KQEQCKETWFYPRVGQSYEEDGVEYNVDTISQVGNRLYIRGWIFSHKQSIDKVRLVVNSL
HYEDSVGLKLVQRTDVANSHNLSDPYCGFSQEVEFSTNEYACVFLEYTQGEQKNRVFITD
VNANTKEAGICIQKRKDYSYNKFVEKFVETYTENICIPQDAFVDLIVPVYNGYEFLENMF
AGIEKTAVPYKLYVVNDCSPDERVLPYLSEYAKSRENVVLLENEENLGFVQSVNRALAQT
SHHVVLVNTDVMLPDQWLERLMLPIWNSDEVASTTPFTNSGTICSFPNFCENNHIFMDKS
ESEIDRYFRMVQPHYVEMPTGVGFCMGMNRKVIDEIGNLDADTFYKGYGEENDWCQRAIR
AGYHNVQVENLFVWHKHGGSFLSEDKKRYIERNSAILEKRYPTYKKDVDIYCAMDPNCQV
REYVKMRMIQDNVEQFIVVLDHDWGGGAGKYMENRIQSMLDHNTAVMRIVDNADVGLQMV
VYYDEYEATFRVDQLEDTCSILTGHQVQQVMINELVAYEHIAQVQQFIIGLKKNFKTEIT
MLCHDFYPVCPSIYLLNDQQKHCFLPANLEECEKCYHNNTNKMNLEYDSIASWRSIWAEF
LSQCDHVITFSENTKSYYEQCYPDIHYEVVPHQVDYIEPVEKIDKTSDLITIGYVGNMMP
SKGSEILIRMAELIEEQGLNARIVVIGPNLSTSANEHLLIHGKYSRDELPELMKEYQVDI
VFIASIWPETFSYTTEEAIKMGMKVAAFDLGAPAERLKKYDKGIIIPEISAEAALDTLLN
NA

Enzyme Prediction     

No EC number prediction in MGYG000000280_01734.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	285	456	7.9e-16	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	9.74e-27	286	525	8	251	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.55e-22	286	497	2	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0438	RfaB	1.46e-19	713	901	140	342	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	1.85e-18	717	902	134	334	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03823	GT4_ExpE7-like	7.92e-16	748	893	169	316	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK78212.1	1.07e-197	145	899	7	783
QMW89726.1	1.07e-197	145	899	7	783
QCU01345.1	2.01e-174	191	900	802	1517
QNM10216.1	1.60e-169	146	900	742	1503
AEE14041.1	8.52e-154	283	900	227	860

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000280_01734.