CAZyme Information: MGYG000000301_02137

Basic Information

• Species: Blautia_A sp900541985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900541985
• CAZyme ID: MGYG000000301_02137
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1012	MGYG000000301_34|CGC1	117382.93	4.7837

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000301	2679417	MAG	Sweden	Europe

• Gene Location: Start: 490; End: 3528 Strand: +

Full Sequence      

MIVPRYYENLSILHENTMPARAYYIPASKRMDNLVEYREESDRMQLLNGTWKFQYFNSIY
DIQESFFEKDYDTENFDEIQVPGVWQMAGYDTHQYTNIRYPFPFDPPYVPQDIPCGAYAH
TFDYKKDEKAPKAFLNFEGVDSCFYVWVNGSYVGYSQVSHMTSEFDITDILQDGENTIAV
LVMKWCDGSYLEDQDKFRMSGIFRDVYILKRPEQAISDYHIKTKIEDMLAKVELDVKFYS
PANVKISIEDKNGAVVAVGSIAEEGTAVLEIASPELWNTENPYLYKMILETENEVIVDHI
ALRKIEIKDQVIYLNGQKIKFRGVNRHDSDPVTGFTISVEQITTDLTLMKQHNFNAIRSS
HYPNAPFFYEMCDKYGFMVIDEADIEAHGPFMLYRKEDTDYNRFKRWNEKIADDPAWELA
IVDRVKLMVERDKNRFCIIMWSMGNESAYGCNFEKALAWTKKFDPDRITQYESARYRNYD
ETYDYSNLDVYSRMYPALSEIQEYLDKDGSKPFLLVEYCHSMGNGPGDFEDYFQMIQDND
KMCGGFVWEWCDHAIAHGTAENGKTIYAYGGDHGEDIHDGNFCMDGLVYPDRTVHTGLLE
YKNVYRPARVVSYNKESGELVLRNYMDFDDLKDYVKISYELTQDGLVISKGKLSEVSVAP
HSEGKTNLKVNVPENGKCYLKLIYHLKKEIPLLEEDHILGFDEIEVSQKDAKCQLVEKWL
EKTVTNSELQVNENDTQIHIKGREFGYTIDRRTALFTEMKFAGREYLNHPMELNIWRAPT
DNDMYIKSEWKKAHYDKAYTRAYATEVVQGKHGVRISSHASVVAETVQKILDVTITWKID
AAGKIDADIAVTKDAEFPDLPRFGVRMFLDKKLSDARYFGMGPQESYRDKHQAASHGLFR
ANVGDLHEDYIRPQENGSHYDCEYVELNNSRYGIVASAEKAFSFNASYYTQEEFEKKTHN
YELTESDSVVLCVDYALNGIGSNSCGPVVLDQYRFNDVVFRFQFTLVPYVKG

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	32	895	5.7e-214	0.9747340425531915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	5	1006	15	1024	beta-galactosidase.
PRK10340	ebgA	0.0	7	1012	4	1003	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.06e-139	36	894	3	804	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	4.01e-92	305	607	1	299	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	1.05e-88	741	1006	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL21217.1	0.0	1	1012	1	1012
QUF79621.1	0.0	1	1012	1	1012
AEN97234.1	0.0	1	1012	1	1012
QQR00153.1	0.0	1	1012	1	1012
ANU45087.1	0.0	1	1012	1	1012

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	2.80e-188	3	1006	1	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	3.83e-188	4	1006	1	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
3OB8_A	2.29e-158	2	1006	11	1029	Structureof the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
3MUY_1	2.17e-149	5	1003	14	1017	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]
1JZ7_A	2.17e-149	5	1003	14	1017	E.COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70753	8.85e-313	1	1007	1	998	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
O33815	5.86e-255	1	1006	1	991	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
Q56307	1.53e-187	3	1006	1	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P06864	4.24e-173	7	1012	4	1003	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
P81650	8.16e-172	47	1006	50	1033	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000301_02137.