CAZyme Information: MGYG000000305_00200

Basic Information

• Species: RF16 sp900542355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16; RF16 sp900542355
• CAZyme ID: MGYG000000305_00200
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514	MGYG000000305_1|CGC2	58219.13	5.1429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000305	2446714	MAG	Sweden	Europe

• Gene Location: Start: 217306; End: 218850 Strand: -

Full Sequence      

MKKIHFVLCSLCLFLCLPAQAQYWWGASVGLGANQPYTDQPDFDLHVQDENNQLVPLFLS
SDGMYMWSDSAFVFSAENGEIHTSYPLTTVRAGSTLRDAYLAAQAKYFPASGLLPDTLFF
TMPQYNTWIELMYNQNQEDILRYAHAIIDNGFPAGVLMIDDNWQRYYGNFDFKAERFPDP
KAMVNELHDLGFRVMLWVCPFVSPDSPEYRDLAAKGYLLQNPNGGTAILNWWNGYSACYD
LTNPDAAAHLVAQLQKMQTEYGIDGFKFDAGDNNCYASAPIRAFNPSATTVDHTTSWAQI
GFSFPFNEYRACWKMGGQPLVQRLGDKDYSWEAVQSLIPCMTTAGLLGYAYTCPDMIGGG
QWASFLGIASDEFNQTLIVRSAQVHALMPMMQFSVAPWRILSEENLRIVRDMARLHAEFA
PYIMDYARHAAQTGEPIVRCMEYQFPHQGFAECKDQFMLGDRYLVAPVVTDATSRTVVLP
KGTWRDEQGKRYRGGRTYTISAPLARLPYFEKIK

Enzyme Prediction     

No EC number prediction in MGYG000000305_00200.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	126	511	9.3e-88	0.9110070257611241

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	1.37e-175	121	484	1	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	2.91e-61	48	512	187	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	3.37e-60	135	510	40	435	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	5.42e-34	55	510	139	616	alpha-glucosidase; Provisional
cd06597	GH31_transferase_CtsY	2.02e-33	128	393	14	287	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBR10752.1	1.02e-244	17	513	29	531
QUT50281.1	2.13e-239	20	514	32	531
ANQ59908.1	1.17e-233	18	513	31	527
ALO49399.1	1.22e-233	6	514	2	528
AKA54123.1	2.36e-233	18	513	31	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	2.67e-30	125	504	269	661	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	2.69e-30	125	504	269	661	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
5F7S_A	3.64e-27	114	513	290	729	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
5F7U_A	4.91e-27	167	512	427	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
1WE5_A	9.21e-27	125	504	269	661	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	9.54e-57	90	492	283	690	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	1.22e-54	90	492	282	692	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
Q5AW25	1.10e-29	125	508	287	687	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P31434	1.46e-29	125	504	269	661	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q9F234	1.49e-29	58	512	158	669	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000405	0.998192	0.000763	0.000214	0.000206	0.000202

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000305_00200.