CAZyme Information: MGYG000000345_00772

Basic Information

• Species: UBA1829 sp002338895
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp002338895
• CAZyme ID: MGYG000000345_00772
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		43841.73	8.7345

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000345	3773289	MAG	Sweden	Europe

• Gene Location: Start: 230249; End: 231418 Strand: -

Full Sequence      

MNLTAKRTSSIPGLPSPLEGCSCAADWTCRRRVEILHLLETHLFGKIPPRPERVRFELKR
RKENVFGGRGSRREITIHLQNGRRKHSIDVLWYLPNRPGTRVPAVIGLNFMGNAASTEET
DLPPDSTEFKPGQQAHRWQIPMLLDAGVSLLTAPRNSFFRDDADGRRTSIFRLFHPASEL
TRAHRELTAISAWAWGYSLLFDLAQTAPEIDPRQIWAHGHSRLGKTALWALANDPRFAGV
VSNDSGCCGASLTRDRHAEAENLPFITRTFPWWFPDVLDSYAGHEDRLPFDQHWLLALAA
PRPLLVASATEDVWADPFNEFRAARAVECVYRLFGARGLGSASFPKPEEPLFGDRVGYYL
RTGKHDVTATDWKFVLEFLRRNAPDSAAG

Enzyme Prediction     

No EC number prediction in MGYG000000345_00772.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	24	381	3.9e-67	0.9219330855018587

CDD Domains     

MGYG000000345_00772 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV74750.1	3.37e-94	14	378	72	453
ARA94045.1	9.28e-94	14	382	37	423
QDT76920.1	4.15e-91	14	378	37	417
QDV48321.1	1.32e-90	14	378	41	421
QEG14499.1	2.34e-90	14	378	37	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	3.89e-81	14	378	7	392	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	6.50e-81	14	378	25	410	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	1.02e-80	14	378	36	421	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	1.82e-80	14	378	25	410	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	5.12e-80	14	378	25	410	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	8.86e-74	14	378	42	422	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
D8QLP9	1.74e-22	10	335	32	324	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
P0CT87	1.38e-19	4	335	96	403	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1
B2ABS0	3.52e-19	25	321	139	398	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
Q7S1X0	3.77e-19	8	360	37	363	4-O-methyl-glucuronoyl methylesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=Cip2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000345_00772.