CAZyme Information: MGYG000000345_01767

Basic Information

• Species: UBA1829 sp002338895
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp002338895
• CAZyme ID: MGYG000000345_01767
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207		24161.92	10.614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000345	3773289	MAG	Sweden	Europe

• Gene Location: Start: 103606; End: 104229 Strand: -

Full Sequence      

MARRYRSRYTRKSHTLILILVSAIALLAAWGLWMAWSAIREYQASRDAYDEIILETADRY
GVDPALVKAVIWRESRFRPYVRGKAGEIGLMQIMPDKAVVDWAKRFRVPVPNRGALFTPR
LNIEIGTWYLGNALRRWSSYQDRLVLALCEYNAGIRRANAWKPNEKNGSVRERITIASTR
SYVDAVLDQYEDYKKSWQKKYPLKGNR

Enzyme Prediction     

No EC number prediction in MGYG000000345_01767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	55	196	2.2e-24	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.57e-41	49	191	4	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.31e-33	48	187	5	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.26e-25	64	191	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.04e-21	34	195	123	285	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	1.23e-21	51	191	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40558.1	3.44e-50	39	193	21	175
AVM45258.1	1.59e-41	53	193	47	187
QDQ41401.1	8.37e-40	49	194	33	180
ACD82159.1	1.95e-39	12	194	3	180
QSR86051.1	5.49e-39	12	194	3	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.53e-14	49	187	416	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.54e-14	49	187	420	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.55e-14	49	187	426	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.56e-14	49	187	430	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.57e-14	49	187	436	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BCE9	1.04e-11	49	195	191	357	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1
P57352	3.37e-11	49	146	69	167	Membrane-bound lytic murein transglycosylase E OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltE PE=3 SV=1
O31608	9.49e-11	50	175	61	176	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
B3GYW8	1.04e-09	49	130	197	279	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=mltC PE=3 SV=1
B0BSH0	1.04e-09	49	130	197	279	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) OX=434271 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.898346	0.002812	0.004118	0.000034	0.000016	0.094701

TMHMM  Annotations     

start	end
13	35