CAZyme Information: MGYG000000353_00078

Basic Information

• Species: UBA7173 sp900548705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900548705
• CAZyme ID: MGYG000000353_00078
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1547	MGYG000000353_1|CGC2	175463.68	4.5285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000353	2738445	MAG	Sweden	Europe

• Gene Location: Start: 96823; End: 101466 Strand: +

Full Sequence      

MKQNFLVLLLLFTSLLPTRAARTYAGGDISLLPLYEQIQSKYYDYDGNPIDDVVKFYAQE
GMNLMRVRLMVNPSAYPGAYSYGSNAKWLGYDPNCCQTLEYILPICKRIKEAGMALLLDF
HYTDYWADPYHQWTPEDWKNIPDDQLPAKLYEYTKESLIWLRERGVVPDMIQTGNEISYG
MLWGPAGTAEGDLKKATGENDRSCWERLTNMLKEAGRACREICPQAQIVIHTEQVANHWN
LWNFYRWMGEFGVDYDIIGLSYYPYWHVDVDKAEEEIADLEKCFPDKKIWIVEFNWPYDW
EADGENVLYEKYPHTPDGQIKITQAVIDMLNRHDNANGLIWWWPEFNKKDYQKYDGETWD
GWYSSPLFNSNDGRALPATRTLAAYAESETVYFTNVPASWSSVGVYAWTDGDNVNEGGWP
GNAAELTDMTYKGKPVWKYTFTGHAHKYLILNNRHLDGNGNWVSTDQTMNLDFEDGGIYW
LSDWRTSDNGQWKYEVWKQDTGTSLDAPCVYLTNIPTGWDNVSLSAWANRGGSDVNEVDG
AALELTDLTYNGKTVYKYTFCGDSHDYLLFHNRPGGNWDSSAQAVVRPFVNGALYILSDA
KNGENGSKYSAPYILSPGFDTTSQGADYLYLFGNINGNEDWHSGRDALKAVRNGLGSYVF
RLSTESECWFRIRTEWTEYGPENNTDRDIYMYDNELRTQADATAAFHLPAGSYTITAEWR
GDNGYMLSIGELKTPVVYPDLYIMSDVQGWNASADRCLEHRGNGVYVYNFPDGITKGSSF
KVSTADWNLSFSSNRGILPNHTYMCNDNNRSGSNMTIPEDIPGPAEVVFDYNLNSFRINA
PNYTGVTDKSNRLYIHFGQNRRYGGNQDATPRVRLHDSTCFFSPSDEELRAAETFELKRV
DPSDITYDLWYYELTPDQMSWAEDATFFFEKTDGSLEKYTCGRHVNGDDFNWDFQNWRKY
IYYSDVADNYNAKAAQSYITWEELSPVRDNDKTDLYIVGEGLQRLAPVTPGTTGWDRIVD
ETIFSSPATMNVFYVEDLTAHELTKSYVLDSDEINEGAKFKMSWLYPWKRWMDSGKSGGE
ICQQRAWATFNLGIVGFSLMRATEKDIELKYGVTKTNREVYFKSSETFPCNNFNQYDWFV
EKKFLGDVKFTLVVDLDKECYSATLLPFAPHPTATVQKVGVKTAQLDSHADADGFWDITP
EPFKAESANGPVKYRKYNVATADVKIDAPNSAAIQESGHTVVYGLYWDKSLSTIYSGNPG
EISLDGIPVSGSGVFGVRAKYTDVQSGFTFHSKFSEGEVKANVNVEAPVIGEPSDKTYVS
GVKYGDRFTFGAYIDIPVQNPSPLNWYADYEVTPSEWSDGDGLSKGGELVHGGHRVFTEN
SGKSFHALDGWTMWSEGDFGDSHDWSHKLSADGNNWPIFLPEVKYFEYKDNYTDSELTTV
LNMDVDAIYPFLVEVNPVPVEKSKSQAVAPSRAGSNLHRLELVRTSANTKSIILDRQVIS
GIEGVEADASTYDVRYFNLQGIEVGGGLTPGVYIRQQGMSATKVIVR

Enzyme Prediction     

No EC number prediction in MGYG000000353_00078.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	25	379	2.4e-76	0.9853801169590644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	6.12e-61	24	378	1	329	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	9.63e-53	26	391	42	399	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam16738	CBM26	1.57e-06	391	461	1	62	Starch-binding module 26. CBM26 is a carbohydrate-binding module that binds starch.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH14955.1	1.94e-95	17	387	41	399
ADE83762.1	3.80e-93	7	390	3	373
QVJ80245.1	2.06e-86	7	390	3	380
QUT66820.1	5.77e-68	2	387	4	365
AGB28452.1	1.04e-65	21	402	20	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	2.40e-40	26	391	53	400	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1HJS_A	5.13e-35	21	344	1	298	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	7.89e-34	21	344	1	298	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
6GPA_A	1.04e-30	26	318	10	291	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
1R8L_A	1.27e-30	26	374	27	362	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	3.55e-43	26	390	9	354	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
P83692	2.81e-34	21	344	1	298	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1
P48841	7.35e-34	24	378	28	361	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
Q0CTQ7	7.56e-34	8	348	1	318	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1
P83691	4.32e-33	21	344	1	298	Arabinogalactan endo-beta-1,4-galactanase OS=Humicola insolens OX=34413 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000344	0.998875	0.000252	0.000192	0.000177	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000353_00078.