CAZyme Information: MGYG000000400_01402

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000000400_01402
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		42441.33	8.6555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000400	2908659	MAG	Sweden	Europe

• Gene Location: Start: 28122; End: 29276 Strand: -

Full Sequence      

MKYFLSAGEASGDIHGAPLMRALRKTDPEAEFVFLGGDDMTAAAAESAPGAAPLIHYRDM
AFMAFSEVLRHLGKIFGNLKTAKKAIADLRPDALILIDYPSFNLKLAKFAHSMGIPVYYY
ISPKVWAWKEWRVKDIRRWCRRVLSILPFEEEYFRGKGMEVEYVGNPSVEEIEHREAALP
SRDDFVRTHGLDPNKPILALVPGSRRGEIRNNLPIMAAVAARFPQLQAVVAGAPAIEPEF
YRQYSTLPVVESATFELMRNAACALVTSGTATLECALLGTPEVVCYRANGSRLSYNIMKR
LIKCPWVSLPNLIAGKEVVPEMLVHLCTVDSVADRLAAIVPGAPGREDMLRGYALMRSRL
GHSDAPTRAAASIVADLKEINQKK

Enzyme Prediction     

No EC number prediction in MGYG000000400_01402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	359	7.4e-112	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.32e-114	1	384	2	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.37e-106	1	379	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.96e-88	4	328	2	327	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.43e-73	5	375	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	5.63e-57	1	331	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	2.30e-152	1	377	1	374
QQR08529.1	4.23e-149	1	373	1	370
ASB37800.1	4.23e-149	1	373	1	370
ANU64105.1	4.23e-149	1	373	1	370
QCP71596.1	2.83e-133	1	377	1	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.82e-40	5	341	11	343	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.82e-40	5	341	11	343	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.02e-80	7	374	11	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1F718	1.94e-72	4	375	8	386	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q1INL4	6.54e-72	1	375	2	376	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q02AZ6	5.52e-70	2	373	3	369	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q2LVL8	1.41e-67	7	379	10	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000400_01402.