CAZyme Information: MGYG000000448_00710

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000000448_00710
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524	MGYG000000448_32|CGC1	58429.61	6.7358

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000448	2372251	MAG	Sweden	Europe

• Gene Location: Start: 1935; End: 3509 Strand: -

Full Sequence      

MKKIIIAAVALFTGAQTLCSAKTVKLAFDYNSPRQTIHSFGASDCWRAQYVGCWPDEKKN
AIADLLFSSETDASGSPRGIGLTLWRFNIGSGSHERGDSSGVESPWRRTECFLDADGNYD
WSKQAGQQWFIKAARDRGVPYILGFSITAPYFMTRNGMTRASENTPYANIKPDKYTDYAA
FMAEVCKHLDIDYLSPINEPQWEWVVSRQEGMQATNRECAALIRLLDKELSKRKARTKVV
FGEAADIRYLYRNGTDKPMRDNQIVDMFTSSGENYIGNCTNVAKIISGHSYWSTWPLDTL
VATRRQLREALPSGYSYWQTEYCPMESNPDNPDGGGQRDTGMDLALYIARIIHYDLTVAE
ASSWQSWTALSEANYKDALIWINDENTLHRPWKNANGNFEETGKTDGAFLPSKYLWALGN
YSFFVRPGMVRLASQTAPGTEEGRGLMASAYADKANGKFVTVIVNYGGTPATVAVDVKNL
PSGVDISRLKCYETSSRSDLKYVGTYASDSLTVPARSVITLVSD

Enzyme Prediction     

No EC number prediction in MGYG000000448_00710.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	25	522	2.1e-178	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.63e-156	23	381	1	367	O-Glycosyl hydrolase family 30.
COG5520	XynC	9.59e-12	7	524	17	429	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCW99529.1	3.34e-141	11	521	18	520
QEM08918.1	8.81e-141	1	521	7	506
QDO68591.1	4.46e-140	22	524	35	538
ACU06063.1	3.35e-139	34	522	50	534
CCH02661.1	3.92e-139	12	521	21	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	4.80e-105	29	522	11	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	9.24e-14	35	522	34	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	2.65e-11	26	522	5	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.55e-10	26	522	12	453	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	2.86e-11	26	522	29	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000997	0.993779	0.004533	0.000246	0.000221	0.000209

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000448_00710.