CAZyme Information: MGYG000000515_00535

Basic Information

• Species: UBA2882 sp900549665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp900549665
• CAZyme ID: MGYG000000515_00535
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000000515_2|CGC1	45522.72	4.5991

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000515	2818145	MAG	Fiji	Oceania

• Gene Location: Start: 166258; End: 167442 Strand: +

Full Sequence      

MKANVKVKGVNLGNWLVLEKWMNPALFEGTDAEDEYWLPRKLSKEVYEARIKIHRSEYIS
ERDFVTIKSWGFDAVRIPVPYFIFGDREPFIGCIEELDKAFNWAERYGLQILIDLHTAPM
GQNGSDNGGICGVCRWAQIPEEVEFELSVLERLAERYGKRKGLWGIEVLNEPALEKIWAT
MDMQSRYPAADAKMAEGSNAISYEFIRKFYLDAFDRIHPHIAEDKYIVIHDGFELNIWKD
FMQEDKYDHVVLDTHQYLMMAEMYGCEQTVDGYLDYIKNRFAKEIAEMQQYFPVICGEWC
LFNSLACGHDTKGGQSVLNGIDGEGAAVISDEKKAEIYRAVAKAQVDAWNCGSGYFYWSY
KLLTDTINTQGWIGWDSWDLGRCVDFGWFPVKDC

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	54	361	3.9e-137	0.9933774834437086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	3.70e-23	5	254	16	249	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	9.28e-06	57	172	22	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT49144.1	1.07e-236	5	390	1	386
ANU75476.1	5.70e-225	7	392	3	388
QQQ93046.1	5.70e-225	7	392	3	388
ASU28285.1	5.70e-225	7	392	3	388
QQR01615.1	1.45e-224	7	392	3	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	1.82e-195	5	392	1	389	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.48e-194	5	392	1	389	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	2.09e-43	7	390	13	391	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	3.07e-34	4	372	6	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
3O6A_A	3.34e-34	4	372	11	372	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8N151	9.17e-48	6	392	30	395	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	9.17e-48	6	392	30	395	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
Q9URU6	1.53e-43	6	390	38	394	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
Q5B5X8	2.92e-42	6	380	28	384	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
P23776	2.48e-41	7	390	53	431	Glucan 1,3-beta-glucosidase I/II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EXG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000515_00535.