CAZyme Information: MGYG000000565_01318

Basic Information

• Species: Collinsella sp900545555
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900545555
• CAZyme ID: MGYG000000565_01318
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		53937.91	5.3533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000565	2194949	MAG	China	Asia

• Gene Location: Start: 1772; End: 3184 Strand: -

Full Sequence      

MRICLVLEGCYPYVHGGVSTWMHGYIQAMPEHEFVLWVIGAHAADRGKFVYELPDNVVEV
HEVFLDDALRLSGEQHEASFDDREREALRRLVSLSNPDWDVLFDIFQRRRVHPLSFLQSR
TFMDIFRDVCLAEYPYTPFADAFHTMRSMLLPVLYLLGSEVPVADVYHAISTGYGGLLAC
LGSSVHHAPVLLTEHGIYTREREEEIIRADWVVPSFKDRWIRFFYLLSEEIYRRAFRVTS
LFHNARKTQIDMGCDADKCLVISNGIQFDRFKDIPLKPDDGWVDIGAVVRLAPIKDVKTM
IYAFFELHERLPKVRLHIMGGVDDEEYGAECHALVDTLGVRDLIFTGRVNVVEYMEKLDF
TILTSISEGQPLSVLESLAARRPCVTTEVGCCRELLEGAPGDDFVTPPMYRKGLADAMER
MCVSRARRIEMGERGQRRVATYFLHEQMLANYRALYDETACAFNLPREGE

Enzyme Prediction     

No EC number prediction in MGYG000000565_01318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	286	432	2.1e-22	0.9125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03813	GT4-like	4.33e-160	2	457	1	474	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria, while some of them are also found in Archaea and eukaryotes.
pfam11997	DUF3492	1.53e-100	1	257	1	278	Domain of unknown function (DUF3492). This presumed domain is functionally uncharacterized. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 259 to 282 amino acids in length. This domain is found associated with pfam00534. This domain has two conserved sequence motifs: GGVS and EHGIY.
NF038011	PelF	8.88e-100	3	456	2	489	GT4 family glycosyltransferase PelF. Proteins of this family are components of the exopolysaccharide Pel transporter. It has been reported that PelF is a soluble glycosyltransferase that uses UDP-glucose as the substrate for the synthesis of exopolysaccharide Pel, whereas PelG is a Wzx-like and PST family exopolysaccharide transporter.
cd03801	GT4_PimA-like	2.36e-33	110	456	33	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.49e-30	131	458	52	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33154.1	0.0	1	470	1	475
AZH69725.1	0.0	1	470	1	475
ATP53448.1	0.0	1	470	1	475
CBL00170.1	4.33e-272	1	465	3	472
AEF26773.1	5.97e-258	1	467	1	472

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000565_01318.