CAZyme Information: MGYG000000583_00462

Basic Information

• Species: Acetatifactor sp900766575
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900766575
• CAZyme ID: MGYG000000583_00462
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000000583_5|CGC3	35847.94	8.2859

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000583	2865631	MAG	Madagascar	Africa

• Gene Location: Start: 86778; End: 87716 Strand: +

Full Sequence      

MEIDVIIPLYKPGKELFTLLDKLGSQSVPVHQVILLNTEEKYFEQLIYGTRFLETYQNIK
VYHVSKREFDHGGTRRMGVKKSSADVFVMMTQDAMPEDDKLIEKLVEPLQGKVAVSYGRQ
LPREDSTPVESYIREFNYPAQSRIKSGEDLGTLGIKTFFCSNVCAAYRREIYEELGGFVK
HTIFNEDMIYAAKAVEAGYAIAYAADAQVVHSHNYTNGQQFCRNFDLGVSQADHPEIFAA
YPSESEGKRMVKDVTAYLRRNHMSAGLPHFYMQCACKYAGYLLGKNYRRLPKKWVLAFTS
NKDYWKQNRKDV

Enzyme Prediction     

No EC number prediction in MGYG000000583_00462.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	176	2.4e-16	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	4.72e-13	3	210	56	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG1216	GT2	8.82e-11	1	221	3	229	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.71e-10	4	172	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13641	Glyco_tranf_2_3	1.48e-07	5	213	6	213	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06423	CESA_like	2.58e-06	5	183	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02100.1	2.40e-207	1	312	1	312
AOZ95578.1	2.27e-113	3	305	4	308
CBL24569.1	2.73e-111	3	306	6	306
ADL33305.1	4.28e-111	3	305	4	308
CBK76837.1	4.27e-110	3	305	29	335

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	4.07e-63	1	305	1	302	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000583_00462.