CAZyme Information: MGYG000000632_01630

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000000632_01630
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000000632_210|CGC1	42128.6	6.7269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000632	2314202	MAG	Madagascar	Africa

• Gene Location: Start: 112; End: 1275 Strand: -

Full Sequence      

MMTHSLRLIAALALSAAFLAPPPSSAAHASLNSPSASASQWQGWDLWETFAKGALEGGRV
VNRSSDNLSTTSEGESYALFFALAADDRENFARILSWTEDNLCGGDCTKRLPAWLWGRRL
EKDPKTGAETEVWGILDRNNAADSDLWIAYALLEAGRLWKNADYLQKGRGLSELILSSSF
DIPGLGRVIPPGEAGFSSRSLARQNPSYYPPFLLKRLEAENPAWRDVRMGAMRTILRGSR
SGFSADWADFDQTGTAHGVNSELGSWDAVRVYLWAGMTSAEDPDAAVLKRALRPMIRTAD
AAGIPPERVEGASLTLSGPGPDAFAACLLPWTRNTRTGAFARTLLAKNEISGYAYYKSVL
TLFGLGFDRGVFAFDAEGRLIKPRAMP

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	44	367	8.6e-65	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	5.42e-115	35	381	16	365	cellulase.
COG3405	BcsZ	4.97e-63	44	374	26	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	1.23e-47	37	370	1	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53782.1	5.04e-228	1	387	28	414
QQS88762.1	1.05e-112	44	384	28	363
QDA53874.1	2.22e-98	44	381	24	359
ANU67169.1	3.65e-91	42	384	20	352
QQQ96024.1	3.65e-91	42	384	20	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7F81_A	6.99e-80	44	380	8	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	1.11e-78	44	380	8	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXQ_A	6.99e-78	44	381	4	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
4Q2B_A	1.30e-76	44	387	4	346	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
3QXF_A	3.85e-74	44	381	4	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8Z289	1.04e-80	44	381	26	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
Q8ZLB7	1.04e-80	44	381	26	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8X5L9	1.27e-78	44	381	25	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	2.00e-77	44	381	25	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	4.15e-64	36	387	25	378	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000322	0.999063	0.000176	0.000158	0.000142	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000632_01630.