CAZyme Information: MGYG000000653_01242

Basic Information

• Species: UBA11471 sp000434215
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp000434215
• CAZyme ID: MGYG000000653_01242
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000000653_7|CGC2	36883.61	7.838

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000653	2583563	MAG	Germany	Europe

• Gene Location: Start: 112033; End: 113010 Strand: +

Full Sequence      

MKNRFKLFMLFLLSCTLLSAAEKPKQLLIVAQDGSGDYTTIQEAIYAIRDYTPVPITVFI
KNGVYNEKLIIPSWKCDITLEGENADSTIISYGDYAGKELIYFGDSIAKMGTFRSHTVLA
AGHRITLENLTIENTAGRVGQAVALHTEGDQIIVRNCRLKGNQDTVFTGNEKSRVYFENC
YIDGTTDFIFGPATCWFENCEIFSKQNSYITAASSAQENPFGYVFHNCRLAAADNVTKVY
LGRPWRAYAAVTFIKCDLGRQIRPEGWENWRNPENEKTARYSEYKNHGEGASTEKRVSWS
RQLSKKEAKQYTRENVLGGNWWQNN

Enzyme Prediction     

No EC number prediction in MGYG000000653_01242.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	317	3.7e-103	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	6.24e-77	29	320	3	298	Pectinesterase.
PLN02773	PLN02773	4.49e-73	24	311	3	290	pectinesterase
COG4677	PemB	4.30e-71	4	320	51	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	5.84e-70	27	322	12	291	putative pectinesterase
PLN02682	PLN02682	4.46e-64	23	322	66	366	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACU59308.1	2.09e-121	11	321	12	322
QHS62623.1	3.42e-120	7	318	8	320
QDO69178.1	6.92e-119	18	311	21	305
AKD03749.1	3.21e-118	1	317	1	318
ALJ01249.1	2.75e-117	28	319	29	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	4.37e-46	29	299	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.67e-41	29	322	10	307	Pectinmethylesterase from Carrot [Daucus carota]
5C1C_A	9.90e-37	19	296	2	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	5.30e-36	19	296	2	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
2NSP_A	1.38e-27	38	318	18	335	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	4.72e-53	30	308	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q5MFV6	2.62e-51	23	323	272	578	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q9SIJ9	2.11e-49	27	322	50	331	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q43062	2.53e-49	29	322	210	508	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q7Y201	1.93e-47	30	321	304	599	Probable pectinesterase/pectinesterase inhibitor 13 OS=Arabidopsis thaliana OX=3702 GN=PME13 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001452	0.540921	0.456779	0.000297	0.000296	0.000255

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000653_01242.