CAZyme Information: MGYG000000657_02562

Basic Information

• Species: Pseudomonas_E bubulae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E bubulae
• CAZyme ID: MGYG000000657_02562
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	MGYG000000657_197|CGC1	56776.96	8.9836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000657	4450077	MAG	Germany	Europe

• Gene Location: Start: 2962; End: 4512 Strand: -

Full Sequence      

MSATVRFPVLPYLLACLLGAFAIAGFWYGLGQPVILPDAATPTHKLQCASYTPFDKDQSP
FDQPFVPRAERLDADLALLATRFQCIRTYSQAGLETLPELARKHGLKLMAGAWVSRDPVA
TEQEVQALIASANANPDVVSAVIVGNEALLRKEVTAPQLVRLIDKVKSQVKQPVTYADVW
EFWLQHPEIAPAVDFLTIHLLPYWEDDPAGIDQAVQHVAQVRQVFGNKFAPKDILIGETG
WPSEGRQRETAQPSRVNEAKFIRGFVTLAEQNGWKYNLIEAFDQPWKRGSEGAVGGYWGL
FDADRQDKGILAGPVSNLPHWPVWLGFGAVLFVGTLLIGGRVRTKRAALTLPALGAVAGC
SIVAWAELASVTSRFAGEWLWAGLLVGLNLIVLTHGALALGQKDGWRERLFNALERRAGW
WLAAAGFAAAVMMLGLVFEPRYRSFPSAALLLPALVYLLRPVGGPRREFGLLALIIGAGI
PVQLYREGLHNEQAWMWALVSVLMVMALWRSVRKRA

Enzyme Prediction     

No EC number prediction in MGYG000000657_02562.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5309	Scw11	7.53e-54	51	305	50	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
pfam00332	Glyco_hydro_17	2.84e-08	86	308	40	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC34395.1	0.0	1	516	1	516
SDU67817.1	0.0	1	516	40	555
ARQ74079.1	0.0	1	516	1	516
ASC88591.1	0.0	1	516	1	516
QPL33798.1	0.0	1	516	15	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FCG_A	1.43e-06	108	311	117	383	Crystalstructure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0Y9Q9	4.42e-18	50	302	312	562	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
Q4WC60	4.42e-18	50	302	312	562	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
B8MXP5	4.52e-16	75	302	369	599	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
Q2US39	4.52e-16	75	302	369	599	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
A1DBG6	9.51e-16	50	302	299	549	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999940	0.000095	0.000002	0.000001	0.000000	0.000003

TMHMM  Annotations     

start	end
7	29
318	340
347	369
379	401
418	437
442	459
468	485
495	512