CAZyme Information: MGYG000000676_00564

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia
• CAZyme ID: MGYG000000676_00564
• CAZy Family: GH94
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810	MGYG000000676_9|CGC1	90806.07	6.7885

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000676	2188584	MAG	Kazakhstan	Asia

• Gene Location: Start: 28294; End: 30726 Strand: -

Full Sequence      

MMKSGYFNQSRLGGYTITDPHLKYSYQYNLLNGDILVQLDQNGPVYIQAAPPGGIVLLRR
EHGEKFSKWLTFFRCGGKIYSNFARPGTECPKSTEIDFLPEKAVYRYIYEDIVSETELFV
SAEGGDVVCSVKLTNVADKELSAEAFAQVFPLIAPVNLSGWDKPEWYVRTSVHHDEKKNL
VFYGRLMNPRGIASARRNVAMLFSGGDVRGAEFLWDDFTGAGDFYRPDAFQREKWNYDFS
VSLPFGERSGKNSVAGFPSVYAAKYAFTLKQGESKIFTQVLSVLPTCGGEIPPETEIDLR
KRYFSAEYRETAAHRARGKWEKLFALNCVHTNDGSFDDYVNGFLPLQMQWVSILDRGWPT
GMRGTRDASNDFMGMLQWNSGFSKRILHHLFECECKNGWFPRQVGENRRGPHDMRNYVDG
GVFVLEFLYEYICYTKDFAFLDELAGYSDSEERESIEKHVLRALGYYAAAENIGEDGLCK
IREGDWFDGVNRAGLAGKGESVTVSCQFYMAVRYMKALFAAAGKSAVPAKIERAAERAAE
SVRKYAFNKAGFFSGLKNDEGKWIFSDADPDGEARMYAVPNAFAVFSKVADKKQRESVLK
NFRRLKTDIGYKLFLPSFRGDVSNVGRIACGDVAEGLLGNSTVYNHGSQGFLCRACCAAG
EGKMAEDVLRFLLPYDQSCHAEEETCSPPYAIVNCYQNVPPFKQRAGFAFLTGTVAVAVR
IVYNFMFGIRPCTEGIAVNPCLTENFDGARVVYNYNGRTLRFLYKKTGKPGIAVNGTMCE
SVVSDVLSGDILPLIPEHLLEDGTKIEICY

Enzyme Prediction     

No EC number prediction in MGYG000000676_00564.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	77	781	6.5e-81	0.6525096525096525

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	5.11e-35	154	776	413	1030	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	3.03e-31	320	730	2	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
pfam17389	Bac_rhamnosid6H	7.53e-04	379	613	61	262	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMV43990.1	8.41e-149	5	802	15	839
VCV22855.1	4.44e-36	118	781	125	757
CBL11429.1	4.44e-36	118	781	125	757
QRT50985.1	1.05e-35	118	781	125	757
QHQ63131.1	7.67e-33	264	786	255	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZLE_A	4.52e-32	217	801	222	790	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]
1V7V_A	2.06e-21	267	789	252	791	Crystalstructure of Vibrio proteolyticus chitobiose phosphorylase [Vibrio proteolyticus],1V7W_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc [Vibrio proteolyticus],1V7X_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc and sulfate [Vibrio proteolyticus]
3QDE_A	1.08e-17	252	794	232	797	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
2CQS_A	7.29e-14	216	778	216	817	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3ACT_A	4.97e-13	216	778	216	817	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8P3J4	1.82e-26	218	790	236	778	Cellobionic acid phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC4077 PE=1 SV=1
Q76IQ9	1.12e-20	267	789	252	791	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
B9K7M6	4.82e-15	289	788	278	801	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
P20471	1.48e-11	154	787	2215	2831	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000676_00564.